1HRJ: Human rantes, NMR, 13 structures

Human rantes, NMR, 13 structures. Determined by solution NMR. Released 14 Oct 1996.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,102
Mol. weight: 15.72 kDa
Released: 14 Oct 1996

Explore 1HRJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HRJ contains 2 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
β-strand	24	1	2
β-strand	28-29	2	3
β-strand	39-42	4	3
β-strand	43	1	2
β-strand	48-50	3	3
α-helix	57-64	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human regulated upon activation normal T-cell expressed and secreted	A, B	protein	68	Homo sapiens	P13501 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1HRJ_1 HUMAN REGULATED UPON ACTIVATION NORMAL T-CELL EXPRESSED AND SECRETED (chains A, B)
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVRE
YINSLEMS

Primary citation

The three-dimensional solution structure of RANTES. Chung, C.W., Cooke, R.M., Proudfoot, A.E. et al. Biochemistry (1995) 34:9307-9314. DOI 10.1021/bi00029a005 · PubMed

Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5COY 1.44 Å, Crystal structure of CC chemokine 5 (CCL5)
6STK 1.52 Å, Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation
1B3A 1.6 Å, Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV…
1EQT 1.6 Å, Met-rantes
6AEZ 1.63 Å, Crystal structure of human CCL5 trimer
1U4P 1.7 Å, Crystal Structure of human RANTES mutant K45E
2VXW 1.7 Å, Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
1U4L 2.0 Å, human RANTES complexed to heparin-derived disaccharide I-S
1U4M 2.0 Å, human RANTES complexed to heparin-derived disaccharide III-S
1U4R 2.2 Å, Crystal Structure of human RANTES mutant 44-AANA-47
5UIW 2.2 Å, Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV…
5L2U 2.28 Å, Oligomer crystal structure of CC chemokine 5 (CCL5)

Browse structure collections

About this viewer

MolViewer shows 1HRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.