Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES. Determined by X-ray diffraction at 1.7 Å resolution. Released 29 Jul 2008.
Explore 2VXW in 3D Show helices and sheets RCSB PDB PDBe
2VXW contains 17 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1 | 1 | 1 |
| β-strand | 6 | 1 | 2 |
| β-strand | 8-10 | 3 | 3 |
| β-strand | 13-15 | 3 | 4 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 5 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 5 |
| β-strand | 48-51 | 4 | 5 |
| α-helix | 56-66 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1 | 1 | 6 |
| β-strand | 6 | 1 | 5 |
| β-strand | 8-10 | 3 | 3 |
| β-strand | 13-15 | 3 | 7 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 2 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 2 |
| β-strand | 48-51 | 4 | 2 |
| α-helix | 56-65 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-15 | 3 | 7 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 1 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 1 |
| β-strand | 48-51 | 4 | 1 |
| α-helix | 56-67 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-15 | 3 | 4 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 6 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 6 |
| β-strand | 48-51 | 4 | 6 |
| α-helix | 58-61 | 4 | |
| α-helix | 63-65 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-C motif chemokine 5 | A, B, C, D | protein | 69 | HOMO SAPIENS | P13501 (AlphaFold model) |
>2VXW_1 C-C MOTIF CHEMOKINE 5 (chains A, B, C, D) FSPLSSQSSACCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVR EYINSLEMS
Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-Rantes. Jin, H., Kagiampakis, I., Li, P. et al. Proteins (2010) 78:295. DOI 10.1002/PROT.22542 · PubMed
Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2VXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.