2VXW: C-C motif chemokine 5

Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES. Determined by X-ray diffraction at 1.7 Å resolution. Released 29 Jul 2008.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 2,435
Mol. weight: 31.67 kDa
Released: 29 Jul 2008

Explore 2VXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VXW contains 17 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1	1	1
β-strand	6	1	2
β-strand	8-10	3	3
β-strand	13-15	3	4
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	5
α-helix	30-31	2
β-strand	39-43	5	5
β-strand	48-51	4	5
α-helix	56-66	11

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1	1	6
β-strand	6	1	5
β-strand	8-10	3	3
β-strand	13-15	3	7
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	2
α-helix	30-31	2
β-strand	39-43	5	2
β-strand	48-51	4	2
α-helix	56-65	10

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	13-15	3	7
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	1
α-helix	30-31	2
β-strand	39-43	5	1
β-strand	48-51	4	1
α-helix	56-67	12

Chain D: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	13-15	3	4
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	6
α-helix	30-31	2
β-strand	39-43	5	6
β-strand	48-51	4	6
α-helix	58-61	4
α-helix	63-65	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 5	A, B, C, D	protein	69	HOMO SAPIENS	P13501 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2VXW_1 C-C MOTIF CHEMOKINE 5 (chains A, B, C, D)
FSPLSSQSSACCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVR
EYINSLEMS

Primary citation

Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-Rantes. Jin, H., Kagiampakis, I., Li, P. et al. Proteins (2010) 78:295. DOI 10.1002/PROT.22542 · PubMed

Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5COY 1.44 Å, Crystal structure of CC chemokine 5 (CCL5)
6STK 1.52 Å, Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation
1B3A 1.6 Å, Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV…
1EQT 1.6 Å, Met-rantes
6AEZ 1.63 Å, Crystal structure of human CCL5 trimer
1U4P 1.7 Å, Crystal Structure of human RANTES mutant K45E
1U4L 2.0 Å, human RANTES complexed to heparin-derived disaccharide I-S
1U4M 2.0 Å, human RANTES complexed to heparin-derived disaccharide III-S
1U4R 2.2 Å, Crystal Structure of human RANTES mutant 44-AANA-47
5UIW 2.2 Å, Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV…
5L2U 2.28 Å, Oligomer crystal structure of CC chemokine 5 (CCL5)
5DNF 2.55 Å, Crystal structure of CC chemokine 5 (CCL5) oligomer in complex with heparin

Browse structure collections

About this viewer

MolViewer shows 2VXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.