6STK: CC-chemokine 5 (CCL5) E66S mutation

Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation. Determined by X-ray diffraction at 1.52 Å resolution. Released 2 Sept 2020.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,194
Mol. weight: 15.79 kDa
Released: 2 Sept 2020

Explore 6STK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6STK contains 8 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	8-11	4	2
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	3
α-helix	30-31	2
β-strand	39-43	5	3
β-strand	48-51	4	3
α-helix	56-65	10

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	2
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	1
α-helix	30-31	2
β-strand	39-43	5	1
β-strand	48-51	4	1
α-helix	56-65	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 5	A, B	protein	68	Homo sapiens	P13501 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6STK_1 C-C motif chemokine 5 (chains A, B)
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVRE
YINSLSMS

Primary citation

Structural characterization of anti-CCL5 activity of the tick salivary protein evasin-4. Denisov, S.S., Ramirez-Escudero, M., Heinzmann, A.C.A. et al. J Biol Chem (2020) 295:14367-14378. DOI 10.1074/jbc.RA120.013891 · PubMed

Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5COY 1.44 Å, Crystal structure of CC chemokine 5 (CCL5)
1B3A 1.6 Å, Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV…
1EQT 1.6 Å, Met-rantes
6AEZ 1.63 Å, Crystal structure of human CCL5 trimer
1U4P 1.7 Å, Crystal Structure of human RANTES mutant K45E
2VXW 1.7 Å, Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
1U4L 2.0 Å, human RANTES complexed to heparin-derived disaccharide I-S
1U4M 2.0 Å, human RANTES complexed to heparin-derived disaccharide III-S
1U4R 2.2 Å, Crystal Structure of human RANTES mutant 44-AANA-47
5UIW 2.2 Å, Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV…
5L2U 2.28 Å, Oligomer crystal structure of CC chemokine 5 (CCL5)
5DNF 2.55 Å, Crystal structure of CC chemokine 5 (CCL5) oligomer in complex with heparin

Browse structure collections

About this viewer

MolViewer shows 6STK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.