1JHJ: APC10

Crystal structure of the APC10/Doc1 subunit of the human anaphase-promoting complex. Determined by X-ray diffraction at 1.6 Å resolution. Released 24 Oct 2001.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,450
Mol. weight: 19.56 kDa
Ligands: NI
Released: 24 Oct 2001

Explore 1JHJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JHJ contains 7 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	13-18	6
β-strand	22-24	3	1
α-helix	26-28	3
β-strand	29-33	5	2
β-strand	37	1	3
β-strand	40	1	3
α-helix	43-46	4
β-strand	54-55	2	4
β-strand	62-74	13	2
β-strand	76-82	7	1
α-helix	83-86	4
α-helix	87-89	3
β-strand	91-99	9	2
β-strand	106-112	7	2
β-strand	117-123	7	1
β-strand	125	1	5
β-strand	131	1	5
β-strand	132-144	13	2
α-helix	145-147	3
β-strand	152-153	2	4
β-strand	155-161	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
APC10	A	protein	171	Homo sapiens	Q9UM13 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JHJ_1 APC10 (chains A)
ATPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQP
HLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIH
VPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPR

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Primary citation

Crystal structure of the APC10/DOC1 subunit of the human anaphase-promoting complex. Wendt, K.S., Vodermaier, H.C., Jacob, U. et al. Nat Struct Biol (2001) 8:784-788. DOI 10.1038/nsb0901-784 · PubMed

Other PDB entries of the same protein (UniProt Q9UM13 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GAW 2.9 Å, High-resolution structure of the Anaphase-promoting complex/cyclosome (APC/C) bound to…
6Q6G 3.2 Å, Cryo-EM structure of the APC/C-Cdc20-Cdk2-cyclinA2-Cks2 complex, the D1 box class
6Q6H 3.2 Å, Cryo-EM structure of the APC/C-Cdc20-Cdk2-cyclinA2-Cks2 complex, the D2 box class
8PKP 3.2 Å, Cryo-EM structure of the apo Anaphase-promoting complex/cyclosome (APC/C) at 3.2…
5G05 3.4 Å, Cryo-EM structure of combined apo phosphorylated APC
8TAU 3.5 Å, APC/C-CDH1-UBE2C-UBE2S-Ubiquitin-CyclinB
4UI9 3.6 Å, Atomic structure of the human Anaphase-Promoting Complex
6TNT 3.78 Å, SUMOylated apoAPC/C with repositioned APC2 WHB domain
6TLJ 3.8 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
5G04 3.9 Å, Structure of the human APC-Cdc20-Hsl1 complex
6TM5 3.9 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the Nek2A…
9N9R 3.9 Å, Model of APC/C-CDC20-UBE2C from H2A/H2B-bound complex

Browse structure collections

About this viewer

MolViewer shows 1JHJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.