NMR Structure of IBiD, A Domain of CBP/p300. Determined by solution NMR. Released 3 Oct 2001.
Explore 1JJS in 3D Show helices and sheets RCSB PDB PDBe
1JJS contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-13 | 8 | |
| α-helix | 26-29 | 4 | |
| α-helix | 35-38 | 4 | |
| α-helix | 40-42 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Creb-binding protein | A | protein | 50 | Mus musculus | P45481 (AlphaFold model) |
>1JJS_1 CREB-BINDING PROTEIN (chains A) GAHMALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVAN
A small domain of CBP/p300 binds diverse proteins: solution structure and functional studies. Lin, C.H., Hare, B.J., Wagner, G. et al. Mol Cell (2001) 8:581-590. DOI 10.1016/S1097-2765(01)00333-1 · PubMed
Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1JJS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.