1KDX: Kix domain of mouse cbp

Kix domain of mouse cbp (creb binding protein) in complex with phosphorylated kinase inducible domain (PKID) of rat creb (cyclic AMP response element binding protein), NMR 17 structures. Determined by solution NMR. Released 25 Nov 1998.

Method: Solution NMR
Organisms: Mus musculus, Rattus norvegicus
Chains: 2
Atoms: 907
Mol. weight: 12.94 kDa
Released: 25 Nov 1998

Explore 1KDX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KDX contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	591-594	4
α-helix	597-611	15
α-helix	617-621	5
α-helix	623-640	18
α-helix	646-658	13
α-helix	659-665	7

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	120-128	9
α-helix	133-144	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CBP	A	protein	81	Mus musculus	P45481 (AlphaFold model)
Creb	B	protein	28	Rattus norvegicus	P15337 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KDX_1 CBP (chains A)
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANS
RDEYYHLLAEKIYKIQKELEE

Sequence of entity 2 (B), FASTA

>1KDX_2 CREB (chains B)
TDSQKRREILSRRPSYRKILNDLSSDAP

Primary citation

Solution structure of the KIX domain of CBP bound to the transactivation domain of CREB: a model for activator:coactivator interactions. Radhakrishnan, I., Perez-Alvarado, G.C., Parker, D. et al. Cell (1997) 91:741-752. DOI 10.1016/S0092-8674(00)80463-8 · PubMed

Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0I 1.43 Å, CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-…
8CNB 1.99 Å, Crystal structure of CREBBP-Y1503C histone acetyltransferase domain in complex with…
4I9O 2.0 Å, Crystal Structure of GACKIX L664C Tethered to 1-10
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
8CMZ 2.25 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with…
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
5U7G 2.4 Å, Crystal Structure of the Catalytic Core of CBP
8CN0 2.44 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with…
8CNA 2.46 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a…
8OG2 2.47 Å, Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
8CND 2.97 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with a…

Browse structure collections

About this viewer

MolViewer shows 1KDX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.