1KHM: C-terminal kh domain of hnrnp K

C-terminal kh domain of hnrnp K (KH3). Determined by solution NMR. Released 12 Jan 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 683
Mol. weight: 9.7 kDa
Released: 12 Jan 2000

Explore 1KHM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KHM contains 5 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	14-21	8	1
α-helix	22-29	8
α-helix	34-43	10
β-strand	46-49	4	1
α-helix	50-53	4
β-strand	58-65	8	1
α-helix	67-81	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (hnrnp K)	A	protein	89	Homo sapiens	P61978 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KHM_1 PROTEIN (HNRNP K) (chains A)
GSPNSYGDLGGPIITTQVTIPKDLARSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRI
ITITGTQDQIQNAQYLLQNSVKQYSGKFF

Primary citation

High precision solution structure of the C-terminal KH domain of heterogeneous nuclear ribonucleoprotein K, a c-myc transcription factor. Baber, J.L., Libutti, D., Levens, D. et al. J Mol Biol (1999) 289:949-962. DOI 10.1006/jmbi.1999.2818 · PubMed

Other PDB entries of the same protein (UniProt P61978 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ZZK 0.95 Å, Crystal Structure of the third KH domain of hnRNP K at 0.95A resolution
7RJO 1.38 Å, Crystal structure of human Bromodomain containing protein 4 (BRD4) in complex with hnRNPK
1ZZI 1.8 Å, Crystal Structure Analysis of the third KH domain of hnRNP K in complex with ssDNA
7RJK 1.85 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with hnRNPK
1ZZJ 2.3 Å, Structure of the third KH domain of hnRNP K in complex with 15-mer ssDNA
7CRU 2.8 Å, hnRNPK NLS in complex with Importin alpha 1 (KPNA2)
7CRE 3.0 Å, hnRNPK KH3 domain in complex with a ssDNA fragment from the SIRLOIN element
1J5K Complex of the KH3 domain of hnrnp K with a single_stranded 10MER DNA oligonucleotide

Browse structure collections

About this viewer

MolViewer shows 1KHM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.