1KKE: Reovirus Attachment Protein Sigma1 Trimer

Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer. Determined by X-ray diffraction at 2.6 Å resolution. Released 21 Dec 2001.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mammalian orthoreovirus 3
Chains: 3
Atoms: 4,899
Mol. weight: 68.06 kDa
Released: 21 Dec 2001

Explore 1KKE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KKE contains 19 α-helices and 67 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	253-254	2	1
β-strand	257	1	2
β-strand	261-264	4	1
β-strand	270-272	3	1
β-strand	274	1	3
β-strand	279-281	3	4
β-strand	287-289	3	4
α-helix	290-295	6
β-strand	296	1	5
β-strand	300-303	4	6
β-strand	306-309	4	6
α-helix	311-314	4
β-strand	316-328	13	7
β-strand	331-344	14	7
β-strand	347-352	6	7
α-helix	353-354	2
β-strand	355-358	4	7
β-strand	363-369	7	7
β-strand	374	1	7
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	8
β-strand	394-404	11	7
β-strand	410-422	13	7
β-strand	425-431	7	7
β-strand	440-443	4	7
α-helix	444-445	2
β-strand	446-451	6	7
β-strand	452	1	8
α-helix	453	1

Chain B: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	257	1	1
β-strand	261-263	3	9
β-strand	269-272	4	9
β-strand	274	1	4
β-strand	279-281	3	10
β-strand	287-289	3	10
β-strand	296	1	6
β-strand	300-303	4	11
β-strand	306-309	4	11
α-helix	311-314	4
β-strand	316-328	13	12
β-strand	331-344	14	12
β-strand	347-352	6	12
α-helix	353-354	2
β-strand	355-358	4	12
β-strand	363-369	7	12
β-strand	374	1	12
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	13
β-strand	394-404	11	12
β-strand	410-422	13	12
β-strand	425-431	7	12
β-strand	440-443	4	12
α-helix	444-445	2
β-strand	446-451	6	12
β-strand	452	1	13
α-helix	453	1

Chain C: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	256-257	2	9
β-strand	261-263	3	2
β-strand	270-272	3	2
β-strand	274	1	10
β-strand	279-281	3	3
β-strand	287-289	3	3
β-strand	296	1	11
β-strand	300-303	4	5
β-strand	306-309	4	5
α-helix	311-314	4
β-strand	316-328	13	14
β-strand	331-344	14	14
β-strand	347-352	6	14
α-helix	353-354	2
β-strand	355-358	4	14
β-strand	363-369	7	14
β-strand	374	1	14
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	15
β-strand	394-404	11	14
β-strand	410-422	13	14
β-strand	425-431	7	14
β-strand	440-443	4	14
α-helix	444-445	2
β-strand	446-451	6	14
β-strand	452	1	15
α-helix	453	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sigma 1 protein	A, B, C	protein	210	Mammalian orthoreovirus 3	P03528

Sequence of entity 1 (A, B, C), FASTA

>1KKE_1 SIGMA 1 PROTEIN (chains A, B, C)
IGATEQSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSG
GIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGD
LSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGV
LRLRVEGGGSITHSNSKWPAMTVSYPRSFT

Primary citation

Crystal structure of reovirus attachment protein sigma1 reveals evolutionary relationship to adenovirus fiber. Chappell, J.D., Prota, A.E., Dermody, T.S. et al. EMBO J (2002) 21:1-11. DOI 10.1093/emboj/21.1.1 · PubMed

Other PDB entries of the same protein (UniProt P03528), best resolution first:

2OJ5 1.75 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at…
2OJ6 1.85 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain D345N mutant
6GAP 2.15 Å, Crystal structure of the T3D reovirus sigma1 coiled coil tail and body
3S6X 2.25 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,3-sialyllactose
3S6Z 2.28 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,8-disialyllactose
3S6Y 2.79 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,6-sialyllactose
3EOY 3.4 Å, Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

Browse structure collections

About this viewer

MolViewer shows 1KKE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.