2OJ6: Viral attachment protein sigma 1

Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain D345N mutant. Determined by X-ray diffraction at 1.85 Å resolution. Released 13 Feb 2007.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Reovirus sp.
Chains: 6
Atoms: 8,505
Mol. weight: 107.57 kDa
Ligands: MG
Released: 13 Feb 2007

Explore 2OJ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OJ6 contains 39 α-helices and 96 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	1
β-strand	300-303	4	2
β-strand	306-309	4	2
α-helix	311-314	4
β-strand	316-328	13	3
β-strand	331-344	14	3
β-strand	347-352	6	3
α-helix	353-354	2
β-strand	355-357	3	3
β-strand	363-369	7	3
β-strand	374	1	3
α-helix	380-383	4
β-strand	385	1	4
β-strand	394-404	11	3
α-helix	409	1
β-strand	410-422	13	3
β-strand	425-431	7	3
β-strand	440-443	4	3
α-helix	444-445	2
β-strand	446-451	6	3
β-strand	452	1	4

Chain B: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	5
β-strand	300-303	4	1
β-strand	306-309	4	1
α-helix	311-314	4
β-strand	316-328	13	6
β-strand	331-344	14	6
β-strand	347-352	6	6
α-helix	353-354	2
β-strand	355-358	4	6
β-strand	364-369	6	6
β-strand	374	1	6
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	7
β-strand	394-404	11	6
α-helix	409	1
β-strand	410-422	13	6
β-strand	425-431	7	6
β-strand	440-443	4	6
α-helix	444-445	2
β-strand	446-451	6	6
β-strand	452	1	7

Chain C: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	2
β-strand	300-303	4	5
β-strand	306-309	4	5
α-helix	311-314	4
β-strand	316-328	13	8
β-strand	331-344	14	8
β-strand	347-352	6	8
α-helix	353-354	2
β-strand	355-358	4	8
β-strand	363-369	7	8
β-strand	374	1	8
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	9
β-strand	394-404	11	8
α-helix	409	1
β-strand	410-422	13	8
β-strand	425-431	7	8
β-strand	440-443	4	8
α-helix	444-445	2
β-strand	446-451	6	8
β-strand	452	1	9
α-helix	453	1

Chain D: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	10
β-strand	300-302	3	11
β-strand	307-309	3	11
α-helix	311-314	4
β-strand	316-328	13	12
β-strand	331-344	14	12
β-strand	347-352	6	12
α-helix	353-354	2
β-strand	355-358	4	12
β-strand	363-369	7	12
β-strand	374	1	12
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	13
β-strand	394-404	11	12
α-helix	409	1
β-strand	410-422	13	12
β-strand	425-431	7	12
β-strand	440-443	4	12
α-helix	444-445	2
β-strand	446-451	6	12
β-strand	452	1	13
α-helix	453	1

Chains E and F: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	14
β-strand	300-303	4	10
β-strand	306-309	4	10
α-helix	311-314	4
β-strand	316-328	13	15
β-strand	331-344	14	15
β-strand	347-352	6	15
α-helix	353-354	2
β-strand	355-357	3	15
β-strand	364-369	6	15
β-strand	374	1	15
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	16
β-strand	394-404	11	15
α-helix	409	1
β-strand	410-422	13	15
β-strand	425-431	7	15
β-strand	440-443	4	15
α-helix	444-445	2
β-strand	446-451	6	15
β-strand	452	1	16
α-helix	453	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Viral attachment protein sigma 1	A, B, C, D, E, F	protein	165	Reovirus sp.	P03528

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>2OJ6_1 Viral attachment protein sigma 1 (chains A, B, C, D, E, F)
GSSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVNDYIHI
CLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGTPQ
YMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

The Reovirus Sigma1 Aspartic Acid Sandwich: A TRIMERIZATION MOTIF POISED FOR CONFORMATIONAL CHANGE. Schelling, P., Guglielmi, K.M., Kirchner, E. et al. J Biol Chem (2007) 282:11582-11589. DOI 10.1074/jbc.M610805200 · PubMed

Other PDB entries of the same protein (UniProt P03528), best resolution first:

2OJ5 1.75 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at…
6GAP 2.15 Å, Crystal structure of the T3D reovirus sigma1 coiled coil tail and body
3S6X 2.25 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,3-sialyllactose
3S6Z 2.28 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,8-disialyllactose
1KKE 2.6 Å, Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer
3S6Y 2.79 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,6-sialyllactose
3EOY 3.4 Å, Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

Browse structure collections

About this viewer

MolViewer shows 2OJ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.