2OJ6: Viral attachment protein sigma 1
Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain D345N mutant. Determined by X-ray diffraction at 1.85 Å resolution. Released 13 Feb 2007.
- Method
- X-ray diffraction
- Resolution
- 1.85 Å
- Organism
- Reovirus sp.
- Chains
- 6
- Atoms
- 8,505
- Mol. weight
- 107.57 kDa
- Ligands
- MG
- Released
- 13 Feb 2007
Explore 2OJ6 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2OJ6 contains 39 α-helices and 96 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 296 | 1 | 1 |
| β-strand | 300-303 | 4 | 2 |
| β-strand | 306-309 | 4 | 2 |
| α-helix | 311-314 | 4 | |
| β-strand | 316-328 | 13 | 3 |
| β-strand | 331-344 | 14 | 3 |
| β-strand | 347-352 | 6 | 3 |
| α-helix | 353-354 | 2 | |
| β-strand | 355-357 | 3 | 3 |
| β-strand | 363-369 | 7 | 3 |
| β-strand | 374 | 1 | 3 |
| α-helix | 380-383 | 4 | |
| β-strand | 385 | 1 | 4 |
| β-strand | 394-404 | 11 | 3 |
| α-helix | 409 | 1 | |
| β-strand | 410-422 | 13 | 3 |
| β-strand | 425-431 | 7 | 3 |
| β-strand | 440-443 | 4 | 3 |
| α-helix | 444-445 | 2 | |
| β-strand | 446-451 | 6 | 3 |
| β-strand | 452 | 1 | 4 |
Chain B: 6 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 296 | 1 | 5 |
| β-strand | 300-303 | 4 | 1 |
| β-strand | 306-309 | 4 | 1 |
| α-helix | 311-314 | 4 | |
| β-strand | 316-328 | 13 | 6 |
| β-strand | 331-344 | 14 | 6 |
| β-strand | 347-352 | 6 | 6 |
| α-helix | 353-354 | 2 | |
| β-strand | 355-358 | 4 | 6 |
| β-strand | 364-369 | 6 | 6 |
| β-strand | 374 | 1 | 6 |
| α-helix | 375 | 1 | |
| α-helix | 380-383 | 4 | |
| β-strand | 385 | 1 | 7 |
| β-strand | 394-404 | 11 | 6 |
| α-helix | 409 | 1 | |
| β-strand | 410-422 | 13 | 6 |
| β-strand | 425-431 | 7 | 6 |
| β-strand | 440-443 | 4 | 6 |
| α-helix | 444-445 | 2 | |
| β-strand | 446-451 | 6 | 6 |
| β-strand | 452 | 1 | 7 |
Chain C: 7 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 296 | 1 | 2 |
| β-strand | 300-303 | 4 | 5 |
| β-strand | 306-309 | 4 | 5 |
| α-helix | 311-314 | 4 | |
| β-strand | 316-328 | 13 | 8 |
| β-strand | 331-344 | 14 | 8 |
| β-strand | 347-352 | 6 | 8 |
| α-helix | 353-354 | 2 | |
| β-strand | 355-358 | 4 | 8 |
| β-strand | 363-369 | 7 | 8 |
| β-strand | 374 | 1 | 8 |
| α-helix | 375 | 1 | |
| α-helix | 380-383 | 4 | |
| β-strand | 385 | 1 | 9 |
| β-strand | 394-404 | 11 | 8 |
| α-helix | 409 | 1 | |
| β-strand | 410-422 | 13 | 8 |
| β-strand | 425-431 | 7 | 8 |
| β-strand | 440-443 | 4 | 8 |
| α-helix | 444-445 | 2 | |
| β-strand | 446-451 | 6 | 8 |
| β-strand | 452 | 1 | 9 |
| α-helix | 453 | 1 | |
Chain D: 7 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 296 | 1 | 10 |
| β-strand | 300-302 | 3 | 11 |
| β-strand | 307-309 | 3 | 11 |
| α-helix | 311-314 | 4 | |
| β-strand | 316-328 | 13 | 12 |
| β-strand | 331-344 | 14 | 12 |
| β-strand | 347-352 | 6 | 12 |
| α-helix | 353-354 | 2 | |
| β-strand | 355-358 | 4 | 12 |
| β-strand | 363-369 | 7 | 12 |
| β-strand | 374 | 1 | 12 |
| α-helix | 375 | 1 | |
| α-helix | 380-383 | 4 | |
| β-strand | 385 | 1 | 13 |
| β-strand | 394-404 | 11 | 12 |
| α-helix | 409 | 1 | |
| β-strand | 410-422 | 13 | 12 |
| β-strand | 425-431 | 7 | 12 |
| β-strand | 440-443 | 4 | 12 |
| α-helix | 444-445 | 2 | |
| β-strand | 446-451 | 6 | 12 |
| β-strand | 452 | 1 | 13 |
| α-helix | 453 | 1 | |
Chains E and F: 7 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 296 | 1 | 14 |
| β-strand | 300-303 | 4 | 10 |
| β-strand | 306-309 | 4 | 10 |
| α-helix | 311-314 | 4 | |
| β-strand | 316-328 | 13 | 15 |
| β-strand | 331-344 | 14 | 15 |
| β-strand | 347-352 | 6 | 15 |
| α-helix | 353-354 | 2 | |
| β-strand | 355-357 | 3 | 15 |
| β-strand | 364-369 | 6 | 15 |
| β-strand | 374 | 1 | 15 |
| α-helix | 375 | 1 | |
| α-helix | 380-383 | 4 | |
| β-strand | 385 | 1 | 16 |
| β-strand | 394-404 | 11 | 15 |
| α-helix | 409 | 1 | |
| β-strand | 410-422 | 13 | 15 |
| β-strand | 425-431 | 7 | 15 |
| β-strand | 440-443 | 4 | 15 |
| α-helix | 444-445 | 2 | |
| β-strand | 446-451 | 6 | 15 |
| β-strand | 452 | 1 | 16 |
| α-helix | 453 | 1 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Viral attachment protein sigma 1 | A, B, C, D, E, F | protein | 165 | Reovirus sp. | P03528 |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>2OJ6_1 Viral attachment protein sigma 1 (chains A, B, C, D, E, F)
GSSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVNDYIHI
CLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGTPQ
YMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 2 |
Primary citation
The Reovirus Sigma1 Aspartic Acid Sandwich: A TRIMERIZATION MOTIF POISED FOR CONFORMATIONAL CHANGE. Schelling, P., Guglielmi, K.M., Kirchner, E. et al. J Biol Chem (2007) 282:11582-11589. DOI 10.1074/jbc.M610805200 · PubMed
Other PDB entries of the same protein (UniProt P03528), best resolution first:
- 2OJ5 1.75 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at…
- 6GAP 2.15 Å, Crystal structure of the T3D reovirus sigma1 coiled coil tail and body
- 3S6X 2.25 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,3-sialyllactose
- 3S6Z 2.28 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,8-disialyllactose
- 1KKE 2.6 Å, Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer
- 3S6Y 2.79 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,6-sialyllactose
- 3EOY 3.4 Å, Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A
Browse structure collections
About this viewer
MolViewer shows 2OJ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.