2OJ5: Viral attachment protein sigma 1

Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution. Determined by X-ray diffraction at 1.75 Å resolution. Released 13 Feb 2007.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Reovirus sp.
Chains: 6
Atoms: 8,851
Mol. weight: 107.64 kDa
Ligands: MG
Released: 13 Feb 2007

Explore 2OJ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OJ5 contains 39 α-helices and 96 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and E: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	1
β-strand	300-303	4	2
β-strand	306-309	4	2
α-helix	311-314	4
β-strand	316-328	13	3
β-strand	331-344	14	3
β-strand	347-352	6	3
α-helix	353-354	2
β-strand	355-358	4	3
β-strand	363-369	7	3
β-strand	374	1	3
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	4
β-strand	394-404	11	3
α-helix	409	1
β-strand	410-422	13	3
β-strand	425-431	7	3
β-strand	440-443	4	3
α-helix	444-445	2
β-strand	446-451	6	3
β-strand	452	1	4
α-helix	453	1

Chain C: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	2
β-strand	300-303	4	5
β-strand	306-309	4	5
α-helix	311-314	4
β-strand	316-328	13	8
β-strand	331-344	14	8
β-strand	347-352	6	8
α-helix	353-354	2
β-strand	355-357	3	8
β-strand	363-369	7	8
β-strand	374	1	8
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	9
β-strand	394-404	11	8
α-helix	409	1
β-strand	410-422	13	8
β-strand	425-431	7	8
β-strand	440-443	4	8
α-helix	444-445	2
β-strand	446-451	6	8
β-strand	452	1	9
α-helix	453	1

Chain D: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	10
β-strand	300-302	3	11
β-strand	307-309	3	11
α-helix	311-314	4
β-strand	316-328	13	12
β-strand	331-344	14	12
β-strand	347-352	6	12
α-helix	353-354	2
β-strand	355-358	4	12
β-strand	363-369	7	12
β-strand	374	1	12
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	13
β-strand	394-404	11	12
α-helix	409	1
β-strand	410-422	13	12
β-strand	425-431	7	12
β-strand	440-443	4	12
α-helix	444-445	2
β-strand	446-451	6	12
β-strand	452	1	13

Chain F: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	296	1	11
β-strand	300-303	4	14
β-strand	306-309	4	14
α-helix	311-314	4
β-strand	316-328	13	17
β-strand	331-344	14	17
β-strand	347-352	6	17
α-helix	353-354	2
β-strand	355-357	3	17
β-strand	363-369	7	17
β-strand	374	1	17
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	18
β-strand	394-404	11	17
β-strand	410-422	13	17
β-strand	425-431	7	17
β-strand	440-443	4	17
α-helix	444-445	2
β-strand	446-451	6	17
β-strand	452	1	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Viral attachment protein sigma 1	A, B, C, D, E, F	protein	165	Reovirus sp.	P03528

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>2OJ5_1 Viral attachment protein sigma 1 (chains A, B, C, D, E, F)
GSSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHI
CLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGTPQ
YMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

The Reovirus Sigma1 Aspartic Acid Sandwich: A TRIMERIZATION MOTIF POISED FOR CONFORMATIONAL CHANGE. Schelling, P., Guglielmi, K.M., Kirchner, E. et al. J Biol Chem (2007) 282:11582-11589. DOI 10.1074/jbc.M610805200 · PubMed

Other PDB entries of the same protein (UniProt P03528), best resolution first:

2OJ6 1.85 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain D345N mutant
6GAP 2.15 Å, Crystal structure of the T3D reovirus sigma1 coiled coil tail and body
3S6X 2.25 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,3-sialyllactose
3S6Z 2.28 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,8-disialyllactose
1KKE 2.6 Å, Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer
3S6Y 2.79 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,6-sialyllactose
3EOY 3.4 Å, Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

Browse structure collections

About this viewer

MolViewer shows 2OJ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.