6GAP: T3D reovirus sigma1 coiled coil tail and body

Crystal structure of the T3D reovirus sigma1 coiled coil tail and body. Determined by X-ray diffraction at 2.15 Å resolution. Released 25 Apr 2018.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Mammalian orthoreovirus 3 Dearing
Chains: 3
Atoms: 5,186
Mol. weight: 84.06 kDa
Released: 25 Apr 2018

Explore 6GAP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GAP contains 5 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-168	141
β-strand	172-173	2	1
β-strand	177-180	4	2
β-strand	183-186	4	2
β-strand	188	1	3
β-strand	192-195	4	4
β-strand	198-201	4	4
β-strand	209-212	4	5
β-strand	215-218	4	5
β-strand	220	1	6
β-strand	225-228	4	7
β-strand	231-234	4	7
α-helix	240-243	4

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-168	141
β-strand	172-173	2	2
β-strand	177-180	4	8
β-strand	183-186	4	8
β-strand	188	1	4
β-strand	192-195	4	9
β-strand	198-201	4	9
β-strand	209-212	4	10
β-strand	215-218	4	10
β-strand	220	1	7
β-strand	225-228	4	11
β-strand	231-234	4	11
α-helix	236-238	3

Chain C: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-168	141
β-strand	172-173	2	8
β-strand	177-180	4	1
β-strand	183-186	4	1
β-strand	188	1	9
β-strand	192-195	4	3
β-strand	198-201	4	3
β-strand	209-212	4	12
β-strand	215-218	4	12
β-strand	220	1	11
β-strand	225-228	4	6
β-strand	231-234	4	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer capsid protein sigma-1	A, B, C	protein	261	Mammalian orthoreovirus 3 Dearing	P03528

Sequence of entity 1 (A, B, C), FASTA

>6GAP_1 Outer capsid protein sigma-1 (chains A, B, C)
MGSSHHHHHHSSGLVPRGSHMASSKGLESRVSALEKTSQIHSDTILRITQGLDDANKRII
ALEQSRDDLVASVSDAQLAISRLESSIGALQTVVNGLDSSVTQLGARVGQLETGLAELRV
DHDNLVARVDTAERNIGSLTTELSTLTLRVTSIQADFESRISTLERTAVTSAGAPLSIRN
NRMTMGLNDGLTLSGNNLAIRLPGNTGLNIQNGGLQFRFNTDQFQIVNNNLTLKTTVFDS
INSRIGATEQSYVASAVTPLR

Primary citation

Structural and Functional Features of the Reovirus sigma 1 Tail. Dietrich, M.H., Ogden, K.M., Long, J.M. et al. J Virol (2018) 92. DOI 10.1128/JVI.00336-18 · PubMed

Other PDB entries of the same protein (UniProt P03528), best resolution first:

2OJ5 1.75 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at…
2OJ6 1.85 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain D345N mutant
3S6X 2.25 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,3-sialyllactose
3S6Z 2.28 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,8-disialyllactose
1KKE 2.6 Å, Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer
3S6Y 2.79 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,6-sialyllactose
3EOY 3.4 Å, Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

Browse structure collections

About this viewer

MolViewer shows 6GAP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.