3S6X: Reovirus attachment protein sigma1

Structure of reovirus attachment protein sigma1 in complex with alpha-2,3-sialyllactose. Determined by X-ray diffraction at 2.25 Å resolution. Released 23 Nov 2011.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Reovirus type 3
Chains: 3
Atoms: 7,624
Mol. weight: 107.98 kDa
Released: 23 Nov 2011

Explore 3S6X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S6X contains 25 α-helices and 101 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	172-173	2	1
β-strand	177-180	4	2
β-strand	183-186	4	2
β-strand	188	1	3
β-strand	192-195	4	4
β-strand	198-201	4	4
β-strand	209-212	4	5
β-strand	215-218	4	5
β-strand	220	1	6
β-strand	225-228	4	7
β-strand	231-234	4	7
α-helix	236-239	4
α-helix	240-250	11
β-strand	256-257	2	8
β-strand	261-264	4	9
β-strand	269-272	4	9
β-strand	274	1	10
β-strand	279-281	3	11
β-strand	287-289	3	11
β-strand	296	1	12
β-strand	300-303	4	13
β-strand	306-309	4	13
α-helix	311-314	4
β-strand	316-328	13	14
β-strand	331-344	14	14
β-strand	347-352	6	14
α-helix	353-354	2
β-strand	355-358	4	14
β-strand	364-369	6	14
β-strand	374	1	14
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	15
β-strand	394-404	11	14
α-helix	409	1
β-strand	410-422	13	14
β-strand	425-431	7	14
β-strand	440-443	4	14
α-helix	444-445	2
β-strand	446-451	6	14
β-strand	452	1	15
α-helix	453	1

Chain B: 9 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	166-167	2	16
β-strand	172-173	2	2
β-strand	177-180	4	17
β-strand	183-186	4	17
β-strand	188	1	4
β-strand	192-195	4	18
β-strand	198-201	4	18
β-strand	209-212	4	19
β-strand	215-218	4	19
β-strand	220	1	7
β-strand	225-228	4	20
β-strand	231-234	4	20
α-helix	236-239	4
α-helix	240-251	12
β-strand	256-257	2	9
β-strand	261-264	4	21
β-strand	269-272	4	21
β-strand	274	1	11
β-strand	279-281	3	22
β-strand	287-289	3	22
α-helix	290-291	2
β-strand	296	1	13
β-strand	300-303	4	23
β-strand	306-309	4	23
α-helix	311-314	4
β-strand	316-328	13	24
β-strand	331-344	14	24
β-strand	347-352	6	24
α-helix	353-354	2
β-strand	355-358	4	24
β-strand	363-369	7	24
β-strand	374	1	24
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	25
β-strand	394-404	11	24
β-strand	410-422	13	24
β-strand	425-431	7	24
β-strand	440-443	4	24
α-helix	444-445	2
β-strand	446-451	6	24
β-strand	452	1	25
α-helix	453	1

Chain C: 7 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	166-167	2	16
β-strand	172-173	2	17
β-strand	177-180	4	1
β-strand	183-186	4	1
β-strand	188	1	18
β-strand	192-195	4	3
β-strand	198-201	4	3
β-strand	209-212	4	26
β-strand	215-218	4	26
β-strand	220	1	20
β-strand	225-228	4	6
β-strand	231-234	4	6
α-helix	237-250	14
β-strand	256-257	2	21
β-strand	261-264	4	8
β-strand	269-272	4	8
β-strand	274	1	22
β-strand	279-281	3	10
β-strand	287-289	3	10
α-helix	290-291	2
β-strand	296	1	23
β-strand	300-303	4	12
β-strand	306-309	4	12
α-helix	311-314	4
β-strand	316-328	13	27
β-strand	331-344	14	27
β-strand	347-352	6	27
α-helix	353-354	2
β-strand	355-357	3	27
β-strand	363-369	7	27
β-strand	374	1	27
α-helix	375	1
α-helix	380-383	4
β-strand	385	1	28
β-strand	394-404	11	27
β-strand	410-422	13	27
β-strand	425-431	7	27
β-strand	440-443	4	27
α-helix	444-445	2
β-strand	446-451	6	27
β-strand	452	1	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer capsid protein sigma-1	A, B, C	protein	325	Reovirus type 3	P03528

Sequence of entity 1 (A, B, C), FASTA

>3S6X_1 Outer capsid protein sigma-1 (chains A, B, C)
QIEDKIEEILSKIYHIENEIARIKKLIGEGSGRPVLNQGVTSAGAPLSIRNNRMTMGLND
GLTLSGNNLAIRLPGNTGLNIQNGGLQFRFNTDQFQIVNNNLTLKTTVFDSINSRIGAIE
QSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRSTSPNLRYPIADVSGGIGMS
PNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNF
VTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGTPQYMSKNLWVEQWQDGVLRLRV
EGGGSITHSNSKWPAMTVSYPRSFT

Primary citation

Crystal structure of reovirus attachment protein sigma1 in complex with sialylated oligosaccharides. Reiter, D.M., Frierson, J.M., Halvorson, E.E. et al. PLoS Pathog (2011) 7:e1002166-e1002166. DOI 10.1371/journal.ppat.1002166 · PubMed

Other PDB entries of the same protein (UniProt P03528), best resolution first:

2OJ5 1.75 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at…
2OJ6 1.85 Å, Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain D345N mutant
6GAP 2.15 Å, Crystal structure of the T3D reovirus sigma1 coiled coil tail and body
3S6Z 2.28 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,8-disialyllactose
1KKE 2.6 Å, Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer
3S6Y 2.79 Å, Structure of reovirus attachment protein sigma1 in complex with alpha-2,6-sialyllactose
3EOY 3.4 Å, Structure of Reovirus sigma1 in Complex with Its Receptor Junctional Adhesion Molecule-A

Browse structure collections

About this viewer

MolViewer shows 3S6X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.