1KPQ: Tsg101 UEV domain

Structure of the Tsg101 UEV domain. Determined by solution NMR. Released 25 May 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,161
Mol. weight: 16.63 kDa
Released: 25 May 2002

Explore 1KPQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KPQ contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	4-11	8
α-helix	18-31	14
β-strand	36-44	9	1
β-strand	48-63	16	1
β-strand	66-75	10	1
β-strand	86-88	3	1
α-helix	89-91	3
β-strand	103	1	2
β-strand	108	1	1
β-strand	109	1	2
α-helix	112-115	4
α-helix	124-137	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor susceptibility gene 101 protein	A	protein	145	Homo sapiens	Q99816 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KPQ_1 Tumor susceptibility gene 101 protein (chains A)
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRP

Primary citation

Structure and functional interactions of the Tsg101 UEV domain. Pornillos, O., Alam, S.L., Rich, R.L. et al. EMBO J (2002) 21:2397-2406. DOI 10.1093/emboj/21.10.2397 · PubMed

Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NLC 1.4 Å, Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
3P9H 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
7ZLX 2.25 Å, Crystal Structure of the TSG101-UEV domain:space group P21

Browse structure collections

About this viewer

MolViewer shows 1KPQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.