1L4Z: Plasminogen

X-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Dec 2002.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Homo sapiens, Streptococcus dysgalactiae subsp. equisimilis
Chains: 2
Atoms: 2,958
Mol. weight: 42.76 kDa
Ligands: CD
Released: 11 Dec 2002

Explore 1L4Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1L4Z contains 17 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	566-567	2	1
α-helix	568-569	2
β-strand	576-581	6	2
β-strand	586-594	9	2
β-strand	597-601	5	2
α-helix	602-605	4
α-helix	611-613	3
β-strand	614-618	5	2
β-strand	622	1	3
α-helix	626-627	2
β-strand	631-640	10	2
β-strand	647-652	6	2
α-helix	664-665	2
β-strand	666	1	1
α-helix	667	1
α-helix	674-675	2
β-strand	679-684	6	1
β-strand	696	1	3
β-strand	698-705	8	1
α-helix	707-710	4
β-strand	724-727	4	1
β-strand	736	1	4
α-helix	740	1
β-strand	744-749	6	1
β-strand	752-759	8	1
α-helix	760	1
β-strand	766	1	4
α-helix	767	1
β-strand	772-776	5	1
α-helix	777-780	4
α-helix	781-789	9

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	11-12	2
β-strand	17-26	10	5
β-strand	32-34	3	5
β-strand	38-41	4	5
β-strand	42	1	6
β-strand	70	1	6
β-strand	73-75	3	7
α-helix	76-88	13
β-strand	98-103	6	5
β-strand	108-110	3	5
α-helix	115	1
β-strand	116-117	2	5
β-strand	124-126	3	7
β-strand	134-145	12	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen	A	protein	248	Homo sapiens	P00747 (AlphaFold model)
Streptokinase	B	protein	136	Streptococcus dysgalactiae subsp. equisimilis	P00779 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1L4Z_1 Plasminogen (chains A)
PSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAH
CLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVI
PACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQST
ELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTW
IEGVMRNN

Sequence of entity 2 (B), FASTA

>1L4Z_2 Streptokinase (chains B)
MIAGPEALLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPASKPFATDSGAMP
HKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQP
VQEFLLSGHVRVRPYK

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	6

Primary citation

Effects of deletion of streptokinase residues 48-59 on plasminogen activation. Wakeham, N., Terzyan, S., Zhai, P. et al. Protein Eng (2002) 15:753-761. DOI 10.1093/protein/15.9.753 · PubMed

Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UGG 1.2 Å, Protease Inhibitor
6D3Y 1.32 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
5UGD 1.38 Å, Protease Inhibitor
6D40 1.43 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
8F7U 1.47 Å, Macrocyclic Plasmin Inhibitor
7UAH 1.57 Å, Macrocyclic plasmin inhibitor
8F7V 1.65 Å, Macrocyclic plasmin inhibitor
5HPG 1.66 Å, Structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
1KRN 1.67 Å, Structure of kringle 4 at 4C temperature and 1.67 Å resolution
6OG4 1.7 Å, plasminogen binding group A streptococcal M protein
1KI0 1.75 Å, The X-ray Structure of Human Angiostatin
4CIK 1.78 Å, plasminogen kringle 1 in complex with inhibitor

Browse structure collections

About this viewer

MolViewer shows 1L4Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.