1L8C: CREB-binding protein

Structural basis for hif-1ALPHA/CBP recognition in the cellular hypoxic response. Determined by solution NMR. Released 10 Apr 2002.

Method: Solution NMR
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,141
Mol. weight: 16.62 kDa
Ligands: ZN
Released: 10 Apr 2002

Explore 1L8C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1L8C contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-28	26
α-helix	40-52	13
α-helix	56-58	3
α-helix	62-76	15
α-helix	85-89	5

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	107-110	4
α-helix	120-126	7
α-helix	128-129	2
α-helix	139-146	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CREB-binding protein	A	protein	95	Mus musculus	P45481 (AlphaFold model)
Hypoxia-inducible factor 1 alpha	B	protein	51	Homo sapiens	Q16665 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1L8C_1 CREB-binding protein (chains A)
ADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQ
VAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKR

Sequence of entity 2 (B), FASTA

>1L8C_2 Hypoxia-inducible factor 1 alpha (chains B)
SDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural basis for Hif-1 alpha /CBP recognition in the cellular hypoxic response. Dames, S.A., Martinez-Yamout, M., De Guzman, R.N. et al. Proc Natl Acad Sci U S A (2002) 99:5271-5276. DOI 10.1073/pnas.082121399 · PubMed

Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0I 1.43 Å, CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-…
8CNB 1.99 Å, Crystal structure of CREBBP-Y1503C histone acetyltransferase domain in complex with…
4I9O 2.0 Å, Crystal Structure of GACKIX L664C Tethered to 1-10
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
8CMZ 2.25 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with…
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
5U7G 2.4 Å, Crystal Structure of the Catalytic Core of CBP
8CN0 2.44 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with…
8CNA 2.46 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a…
8OG2 2.47 Å, Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
8CND 2.97 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with a…

Browse structure collections

About this viewer

MolViewer shows 1L8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.