1LQS: Human cytomegalovirus il-10

Crystal structure of human cytomegalovirus il-10 bound to soluble human il-10R1. Determined by X-ray diffraction at 2.7 Å resolution. Released 17 Jul 2002.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Human herpesvirus 5
Chains: 4
Atoms: 5,699
Mol. weight: 85.74 kDa
Ligands: NAG
Released: 17 Jul 2002

Explore 1LQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LQS contains 38 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain L: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	10-12	3
α-helix	16-19	4
α-helix	20-37	18
α-helix	61-71	11
α-helix	72-76	5
α-helix	77-83	7
α-helix	85-87	3
α-helix	88-105	18
α-helix	109-111	3
α-helix	117-127	11
α-helix	136-141	6
α-helix	143-156	14

Chain M: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	10-12	3
α-helix	16-18	3
α-helix	20-37	18
α-helix	61-71	11
α-helix	72-76	5
α-helix	77-81	5
α-helix	85-87	3
α-helix	88-106	19
α-helix	109-111	3
α-helix	118-129	12
α-helix	136-141	6
α-helix	143-156	14

Chain R: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	11-16	6	1
β-strand	19-24	6	1
α-helix	25-27	3
β-strand	35-42	8	2
β-strand	48-55	8	2
β-strand	59-61	3	1
α-helix	63-65	3
α-helix	69-71	3
β-strand	75-83	9	2
β-strand	86-87	2	2
β-strand	91-92	2	2
β-strand	97	1	2
α-helix	99-101	3
β-strand	102-103	2	1
β-strand	104	1	3
β-strand	108-114	7	4
β-strand	117-123	7	4
α-helix	136-139	4
β-strand	144-152	9	5
β-strand	160-164	5	5
β-strand	168-172	5	4
β-strand	179-188	10	5
β-strand	195	1	3
α-helix	197-200	4
β-strand	201-204	4	5

Chain S: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	11-16	6	6
β-strand	19-24	6	6
α-helix	25-27	3
β-strand	35-42	8	7
β-strand	49-55	7	7
β-strand	59-61	3	6
α-helix	63-65	3
α-helix	67-71	5
β-strand	75-83	9	7
β-strand	86-87	2	7
β-strand	91-92	2	7
β-strand	97	1	7
α-helix	99-101	3
β-strand	102-103	2	6
β-strand	104	1	8
β-strand	108-114	7	9
β-strand	117-123	7	9
α-helix	136-139	4
β-strand	144-152	9	10
β-strand	160-164	5	10
β-strand	168-172	5	9
β-strand	179-188	10	10
β-strand	195	1	8
α-helix	197-200	4
β-strand	201-204	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-10 receptor alpha chain	R, S	protein	214	Homo sapiens	Q13651 (AlphaFold model)
Interleukin-10-like protein	L, M	protein	157	Human herpesvirus 5	P17150

Sequence of entity 1 (R, S), FASTA

>1LQS_1 INTERLEUKIN-10 RECEPTOR ALPHA CHAIN (chains R, S)
HGTELPSPPSVWFEAEFFHHILHWTPIPQQSESTCYEVALLRYGIESWNSISQCSQTLSY
DLTAVTLDLYHSNGYRARVRAVDGSRHSQWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG
KIQLPRPKMAPAQDTYESIFSHFREYEIAIRKVPGQFTFTHKKVKHEQFSLLTSGEVGEF
CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN

Sequence of entity 2 (L, M), FASTA

>1LQS_2 INTERLEUKIN-10-LIKE PROTEIN (chains L, M)
SEEAKPATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGC
WGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVI
SRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Crystal structure of human cytomegalovirus IL-10 bound to soluble human IL-10R1. Jones, B.C., Logsdon, N.J., Josephson, K. et al. Proc Natl Acad Sci U S A (2002) 99:9404-9409. DOI 10.1073/pnas.152147499 · PubMed

Other PDB entries of the same protein (UniProt Q13651 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Y6K 2.52 Å, Crystal structure of human IL-10 complexed with the soluble IL-10R1 chain
5IXI 2.57 Å, Structure of human JAK1 FERM/SH2 in complex with IFNLR1/IL10RA chimera
1Y6N 2.7 Å, Crystal structure of Epstein-Barr virus IL-10 mutant (A87I) complexed with the soluble…
1Y6M 2.8 Å, Crystal structure of Epstein-Barr virus IL-10 complexed with the soluble IL-10R1 chain
1J7V 2.9 Å, Human il-10 / il-10R1 complex
6X93 3.5 Å, Interleukin-10 signaling complex with IL-10RA and IL-10RB

Browse structure collections

About this viewer

MolViewer shows 1LQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.