1M4P: Tsg101 UEV domain

Structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP "late domain" peptide, DYANA Ensemble. Determined by solution NMR. Released 6 Nov 2002.

Method: Solution NMR
Organisms: Homo sapiens, Human immunodeficiency virus 1
Chains: 2
Atoms: 1,228
Mol. weight: 17.6 kDa
Released: 6 Nov 2002

Explore 1M4P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M4P contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-12	9
α-helix	18-31	14
β-strand	35-43	9	1
β-strand	49-62	14	1
β-strand	67-76	10	1
β-strand	87-88	2	1
β-strand	108	1	1
α-helix	124-137	14

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	208	1	1
α-helix	210-212	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor Susceptibility gene 101 protein	A	protein	145	Homo sapiens	Q99816 (AlphaFold model)
Gag Polyprotein	B	protein	9	Human immunodeficiency virus 1	Q9IF21

Sequence of entity 1 (A), FASTA

>1M4P_1 Tumor Susceptibility gene 101 protein (chains A)
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRP

Sequence of entity 2 (B), FASTA

>1M4P_2 Gag Polyprotein (chains B)
PEPTAPPEE

Primary citation

Structure of the Tsg101 UEV domain in complex with the PTAP motif of the HIV-1 p6 protein. Pornillos, O., Alam, S.L., Davis, D.R. et al. Nat Struct Biol (2002) 9:812-817. PubMed

Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NLC 1.4 Å, Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
3P9H 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
7ZLX 2.25 Å, Crystal Structure of the TSG101-UEV domain:space group P21

Browse structure collections

About this viewer

MolViewer shows 1M4P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.