Structure of the TSG101 uev domain in complex with a HIV-1 ptap "late domain" peptide, cns ensemble. Determined by solution NMR. Released 6 Nov 2002.
Explore 1M4Q in 3D Show helices and sheets RCSB PDB PDBe
1M4Q contains 4 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-12 | 9 | |
| α-helix | 18-32 | 15 | |
| β-strand | 35-38 | 4 | 1 |
| β-strand | 41-43 | 3 | 2 |
| β-strand | 49-51 | 3 | 2 |
| β-strand | 54-62 | 9 | 1 |
| β-strand | 67-75 | 9 | 1 |
| β-strand | 87-89 | 3 | 1 |
| β-strand | 97 | 1 | 3 |
| β-strand | 100 | 1 | 4 |
| β-strand | 103 | 1 | 4 |
| β-strand | 108 | 1 | 1 |
| α-helix | 124-137 | 14 | |
| β-strand | 141 | 1 | 3 |
| α-helix | 142-144 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor Susceptibility gene 101 protein | A | protein | 145 | Homo sapiens | Q99816 (AlphaFold model) |
| Gag Polyprotein | B | protein | 9 | Human immunodeficiency virus 1 | Q9IF21 |
>1M4Q_1 Tumor Susceptibility gene 101 protein (chains A) MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP QSDLLGLIQVMIVVFGDEPPVFSRP
>1M4Q_2 Gag Polyprotein (chains B) PEPTAPPEE
Structure of the Tsg101 UEV domain in complex with the PTAP motif of the HIV-1 p6 protein. Pornillos, O., Alam, S.L., Davis, D.R. et al. Nat Struct Biol (2002) 9:812-817. PubMed
Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1M4Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.