2H3L: ERBIN PDZ

Crystal Structure of ERBIN PDZ. Determined by X-ray diffraction at 1.0 Å resolution. Released 13 Jun 2006.

Method: X-ray diffraction
Resolution: 1.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,811
Mol. weight: 22.39 kDa
Released: 13 Jun 2006

Explore 2H3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2H3L contains 4 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1318-1327	10	1
β-strand	1334-1338	5	1
β-strand	1354-1359	6	1
α-helix	1373	1
β-strand	1374-1378	5	1
β-strand	1381-1382	2	1
α-helix	1388-1397	10
β-strand	1401-1410	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LAP2 protein	A, B	protein	103	Homo sapiens	Q96RT1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2H3L_1 LAP2 protein (chains A, B)
GSHMGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLL
QPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS

Primary citation

Comparative structural analysis of the Erbin PDZ domain and the first PDZ domain of ZO-1. Insights into determinants of PDZ domain specificity. Appleton, B.A., Zhang, Y., Wu, P. et al. J Biol Chem (2006) 281:22312-22320. DOI 10.1074/jbc.M602901200 · PubMed

Other PDB entries of the same protein (UniProt Q96RT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Q0N 1.18 Å, Structure of the Erbin PDB domain in complex with a high-affinity peptide
6Q0M 1.2 Å, Structure of Erbin PDZ derivative E-14 with a high-affinity peptide
1MFG 1.25 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
7LUL 1.65 Å, Structure of the MM2 Erbin PDZ variant in complex with a high-affinity peptide
2QBW 1.8 Å, The crystal structure of PDZ-Fibronectin fusion protein
6UBH 1.8 Å, Structure of the MM7 Erbin PDZ variant in complex with a high-affinity peptide
1MFL 1.88 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
6Q0U 1.89 Å, Structure of the Erbin PDZ variant E-6a with a high-affinity C-terminal peptide
3CH8 1.9 Å, The crystal structure of PDZ-Fibronectin fusion protein
1N7T ERBIN PDZ domain bound to a phage-derived peptide

Browse structure collections

About this viewer

MolViewer shows 2H3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.