7LUL: MM2 Erbin PDZ variant

Structure of the MM2 Erbin PDZ variant in complex with a high-affinity peptide. Determined by X-ray diffraction at 1.65 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 1.65 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,043
Mol. weight: 12.04 kDa
Released: 28 Jul 2021

Explore 7LUL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LUL contains 2 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	20-28	9	1
β-strand	35-39	5	1
β-strand	55-60	6	1
α-helix	74	1
β-strand	75-79	5	1
β-strand	82-83	2	1
α-helix	89-98	10
β-strand	102-110	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	0-1	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Erbin	A	protein	95	Homo sapiens	Q96RT1 (AlphaFold model)
peptide	B	protein	7	synthetic construct

Sequence of entity 1 (A), FASTA

>7LUL_1 Erbin (chains A)
SSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQ
ANGYSFINIRLEEAERLLKTFQNTVELIIVREVSS

Sequence of entity 2 (B), FASTA

>7LUL_2 peptide (chains B)
RWYERWV

Primary citation

Comprehensive Assessment of the Relationship Between Site -2 Specificity and Helix alpha 2 in the Erbin PDZ Domain. Teyra, J., McLaughlin, M., Singer, A. et al. J Mol Biol (2021) 433:167115-167115. DOI 10.1016/j.jmb.2021.167115 · PubMed

Other PDB entries of the same protein (UniProt Q96RT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H3L 1.0 Å, Crystal Structure of ERBIN PDZ
6Q0N 1.18 Å, Structure of the Erbin PDB domain in complex with a high-affinity peptide
6Q0M 1.2 Å, Structure of Erbin PDZ derivative E-14 with a high-affinity peptide
1MFG 1.25 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
2QBW 1.8 Å, The crystal structure of PDZ-Fibronectin fusion protein
6UBH 1.8 Å, Structure of the MM7 Erbin PDZ variant in complex with a high-affinity peptide
1MFL 1.88 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
6Q0U 1.89 Å, Structure of the Erbin PDZ variant E-6a with a high-affinity C-terminal peptide
3CH8 1.9 Å, The crystal structure of PDZ-Fibronectin fusion protein
1N7T ERBIN PDZ domain bound to a phage-derived peptide

Browse structure collections

About this viewer

MolViewer shows 7LUL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.