2QBW: PDZ-Fibronectin fusion protein

The crystal structure of PDZ-Fibronectin fusion protein. Determined by X-ray diffraction at 1.8 Å resolution. Released 22 Apr 2008.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,741
Mol. weight: 21.89 kDa
Released: 22 Apr 2008

Explore 2QBW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QBW contains 5 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	26-31	6	1
α-helix	45	1
β-strand	46-50	5	1
β-strand	53-54	2	1
α-helix	60-69	10
β-strand	73-81	9	1
β-strand	87-95	9	1
β-strand	111-116	6	2
β-strand	119-123	5	2
β-strand	133-140	8	3
α-helix	146-147	2
β-strand	148-153	6	3
β-strand	158-161	4	2
α-helix	164-165	2
β-strand	169-177	9	3
β-strand	185	1	3
α-helix	186-188	3
β-strand	189-194	6	3

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	10-12	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PDZ-Fibronectin fusion protein	A	protein	195	Homo sapiens	Q96RT1 (AlphaFold model)
Polypeptide	B	protein	8

Sequence of entity 1 (A), FASTA

>2QBW_1 PDZ-Fibronectin fusion protein (chains A)
SPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEH
GQAVSLLKTFQNTVELIIVREVGNGAKQEIRVRVEKDGGSGGVSSVPTNLEVVAATPTSL
LISWDASYYGVSYYRITYGETGGNSPVQEFTVPYSSSTATISGLKPGVDYTITVYAYSDY
YGSHHYSPISINYRT

Sequence of entity 2 (B), FASTA

>2QBW_2 Polypeptide (chains B)
PQPVDSWV

Primary citation

Design of protein function leaps by directed domain interface evolution. Huang, J., Koide, A., Makabe, K. et al. Proc Natl Acad Sci U S A (2008) 105:6578-6583. DOI 10.1073/pnas.0801097105 · PubMed

Other PDB entries of the same protein (UniProt Q96RT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H3L 1.0 Å, Crystal Structure of ERBIN PDZ
6Q0N 1.18 Å, Structure of the Erbin PDB domain in complex with a high-affinity peptide
6Q0M 1.2 Å, Structure of Erbin PDZ derivative E-14 with a high-affinity peptide
1MFG 1.25 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
7LUL 1.65 Å, Structure of the MM2 Erbin PDZ variant in complex with a high-affinity peptide
6UBH 1.8 Å, Structure of the MM7 Erbin PDZ variant in complex with a high-affinity peptide
1MFL 1.88 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
6Q0U 1.89 Å, Structure of the Erbin PDZ variant E-6a with a high-affinity C-terminal peptide
3CH8 1.9 Å, The crystal structure of PDZ-Fibronectin fusion protein
1N7T ERBIN PDZ domain bound to a phage-derived peptide

Browse structure collections

About this viewer

MolViewer shows 2QBW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.