Structure of the Erbin PDB domain in complex with a high-affinity peptide. Determined by X-ray diffraction at 1.18 Å resolution. Released 13 Nov 2019.
Explore 6Q0N in 3D Show helices and sheets RCSB PDB PDBe
6Q0N contains 4 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-9 | 9 | 1 |
| β-strand | 16-20 | 5 | 1 |
| β-strand | 22 | 1 | 2 |
| β-strand | 36-41 | 6 | 1 |
| α-helix | 55 | 1 | |
| β-strand | 56-60 | 5 | 1 |
| β-strand | 63-64 | 2 | 1 |
| β-strand | 69 | 1 | 2 |
| α-helix | 70-79 | 10 | |
| β-strand | 83-91 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -1-1 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | -1-0 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Erbin | A, B | protein | 93 | Homo sapiens | Q96RT1 (AlphaFold model) |
| peptide | C, D | protein | 7 | synthetic construct |
>6Q0N_1 Erbin (chains A, B) SSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQ ANGYSFINIEHGQAVSLLKTFQNTVELIIVREV
>6Q0N_2 peptide (chains C, D) TGYETWV
Comprehensive analysis of all evolutionary paths between two divergent PDZ domain specificities. Teyra, J., Ernst, A., Singer, A. et al. Protein Sci (2020) 29:433-442. DOI 10.1002/pro.3759 · PubMed
Other PDB entries of the same protein (UniProt Q96RT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Q0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.