1MFG: ERBIN PDZ domain

The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor. Determined by X-ray diffraction at 1.25 Å resolution. Released 21 Jan 2003.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 958
Mol. weight: 11.3 kDa
Released: 21 Jan 2003

Explore 1MFG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MFG contains 2 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1278-1286	9	1
β-strand	1293-1297	5	1
β-strand	1299	1	2
β-strand	1313-1318	6	1
α-helix	1332	1
β-strand	1333-1337	5	1
β-strand	1340-1341	2	1
β-strand	1346	1	2
α-helix	1347-1356	10
β-strand	1360-1368	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1253-1254	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Erb-B2 interacting protein	A	protein	95	Homo sapiens	Q96RT1 (AlphaFold model)
Erb-B2 carboxyl-terminal fragment	B	protein	9		P04626 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MFG_1 Erb-B2 INTERACTING PROTEIN (chains A)
GSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQ
ANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS

Sequence of entity 2 (B), FASTA

>1MFG_2 Erb-B2 carboxyl-terminal fragment (chains B)
EYLGLDVPV

Primary citation

Novel mode of ligand recognition by the erbin PDZ domain. Birrane, G., Chung, J., Ladias, J.A. J Biol Chem (2003) 278:1399-1402. DOI 10.1074/jbc.C200571200 · PubMed

Other PDB entries of the same protein (UniProt Q96RT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H3L 1.0 Å, Crystal Structure of ERBIN PDZ
6Q0N 1.18 Å, Structure of the Erbin PDB domain in complex with a high-affinity peptide
6Q0M 1.2 Å, Structure of Erbin PDZ derivative E-14 with a high-affinity peptide
7LUL 1.65 Å, Structure of the MM2 Erbin PDZ variant in complex with a high-affinity peptide
2QBW 1.8 Å, The crystal structure of PDZ-Fibronectin fusion protein
6UBH 1.8 Å, Structure of the MM7 Erbin PDZ variant in complex with a high-affinity peptide
1MFL 1.88 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
6Q0U 1.89 Å, Structure of the Erbin PDZ variant E-6a with a high-affinity C-terminal peptide
3CH8 1.9 Å, The crystal structure of PDZ-Fibronectin fusion protein
1N7T ERBIN PDZ domain bound to a phage-derived peptide

Browse structure collections

About this viewer

MolViewer shows 1MFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.