1N69: Human saposin B

Crystal structure of human saposin B. Determined by X-ray diffraction at 2.2 Å resolution. Released 7 Jan 2003.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,955
Mol. weight: 28.13 kDa
Ligands: 3PE
Released: 7 Jan 2003

Explore 1N69 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N69 contains 15 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	2-20	19
α-helix	24-35	12
α-helix	36-39	4
α-helix	43-62	20
α-helix	67-73	7

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-20	18
α-helix	26-34	9
α-helix	35-39	5
α-helix	43-62	20
α-helix	67-74	8

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	2-20	19
α-helix	24-36	13
α-helix	37-39	3
α-helix	43-62	20
α-helix	67-74	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Saposin B	A, B, C	protein	81	Homo sapiens	P07602 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1N69_1 SAPOSIN B (chains A, B, C)
MDGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIA
IQMMMHMQPKEICALVGFCDE

Ligands and cofactors

ID	Name	Formula	Copies
3PE	1,2-Distearoyl-sn-glycerophosphoethanolamine	C41 H82 N O8 P	1

Primary citation

Crystal Structure of saposin B reveals a dimeric shell for lipid binding. Ahn, V.E., Faull, K.F., Whitelegge, J.P. et al. Proc Natl Acad Sci U S A (2003) 100:38-43. DOI 10.1073/pnas.0136947100 · PubMed

Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQP 1.3 Å, Crystal Structure of Human Saposin D (orthorhombic)
9I63 1.65 Å, Synthetic Human Saposin D glycoprotein
4UEX 1.8 Å, Structure of human Saposin A at lysosomal pH
4DDJ 1.9 Å, Crystal structure of saposin A in complex with lauryldimethylamine-N-oxide (LDAO)
2DOB 2.0 Å, Crystal Structure of Human Saposin A
3BQQ 2.0 Å, Crystal Structure of Human Saposin D (triclinic)
2RB3 2.1 Å, Crystal Structure of Human Saposin D
4V2O 2.13 Å, Structure of saposin B in complex with chloroquine
6SLR 2.38 Å, Structure of saposin B in complex with atovaquone
2GTG 2.4 Å, Crystal Structure of Human Saposin C
2QYP 2.45 Å, Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation
2R0R 2.5 Å, Crystal Structure of Human Saposin D variant SapD K9E

Browse structure collections

About this viewer

MolViewer shows 1N69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.