2QYP: Proactivator polypeptide

Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation. Determined by X-ray diffraction at 2.45 Å resolution. Released 29 Apr 2008.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,242
Mol. weight: 20.76 kDa
Released: 29 Apr 2008

Explore 2QYP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QYP contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2-19	18
α-helix	22-37	16
α-helix	47-64	18
α-helix	68-73	6

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	-1-19	21
α-helix	22-37	16
α-helix	41-54	14
α-helix	55-57	3
α-helix	58-64	7
α-helix	68-74	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proactivator polypeptide	A, B	protein	91	Homo sapiens	P07602 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QYP_1 Proactivator polypeptide (chains A, B)
AYVSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSS
ILSILLEEVSPELVCSMLHLCSGTRHHHHHH

Primary citation

Crystal structures of human saposins C and d: implications for lipid recognition and membrane interactions. Rossmann, M., Schultz-Heienbrok, R., Behlke, J. et al. Structure (2008) 16:809-817. DOI 10.1016/j.str.2008.02.016 · PubMed

Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQP 1.3 Å, Crystal Structure of Human Saposin D (orthorhombic)
9I63 1.65 Å, Synthetic Human Saposin D glycoprotein
4UEX 1.8 Å, Structure of human Saposin A at lysosomal pH
4DDJ 1.9 Å, Crystal structure of saposin A in complex with lauryldimethylamine-N-oxide (LDAO)
2DOB 2.0 Å, Crystal Structure of Human Saposin A
3BQQ 2.0 Å, Crystal Structure of Human Saposin D (triclinic)
2RB3 2.1 Å, Crystal Structure of Human Saposin D
4V2O 2.13 Å, Structure of saposin B in complex with chloroquine
1N69 2.2 Å, Crystal structure of human saposin B
6SLR 2.38 Å, Structure of saposin B in complex with atovaquone
2GTG 2.4 Å, Crystal Structure of Human Saposin C
2R0R 2.5 Å, Crystal Structure of Human Saposin D variant SapD K9E

Browse structure collections

About this viewer

MolViewer shows 2QYP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.