2DOB: Human Saposin A

Crystal Structure of Human Saposin A. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Jul 2006.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 686
Mol. weight: 9.24 kDa
Ligands: CA
Released: 25 Jul 2006

Explore 2DOB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DOB contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	2-19	18
α-helix	24-34	11
α-helix	35-37	3
α-helix	41-61	21
α-helix	69-75	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proactivator polypeptide	A	protein	83	Homo sapiens	P07602 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DOB_1 Proactivator polypeptide (chains A)
MGSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVI
LDIIKGEMSRPGEVCSALNLCES

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Crystal structures of saposins A and C. Ahn, V.E., Leyko, P., Alattia, J.R. et al. Protein Sci (2006) 15:1849-1857. DOI 10.1110/ps.062256606 · PubMed

Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQP 1.3 Å, Crystal Structure of Human Saposin D (orthorhombic)
9I63 1.65 Å, Synthetic Human Saposin D glycoprotein
4UEX 1.8 Å, Structure of human Saposin A at lysosomal pH
4DDJ 1.9 Å, Crystal structure of saposin A in complex with lauryldimethylamine-N-oxide (LDAO)
3BQQ 2.0 Å, Crystal Structure of Human Saposin D (triclinic)
2RB3 2.1 Å, Crystal Structure of Human Saposin D
4V2O 2.13 Å, Structure of saposin B in complex with chloroquine
1N69 2.2 Å, Crystal structure of human saposin B
6SLR 2.38 Å, Structure of saposin B in complex with atovaquone
2GTG 2.4 Å, Crystal Structure of Human Saposin C
2QYP 2.45 Å, Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation
2R0R 2.5 Å, Crystal Structure of Human Saposin D variant SapD K9E

Browse structure collections

About this viewer

MolViewer shows 2DOB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.