Synthetic Human Saposin D glycoprotein. Determined by X-ray diffraction at 1.65 Å resolution. Released 9 Apr 2025.
Explore 9I63 in 3D Show helices and sheets RCSB PDB PDBe
9I63 contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 409-422 | 14 | |
| α-helix | 429-439 | 11 | |
| α-helix | 440-442 | 3 | |
| α-helix | 445-447 | 3 | |
| α-helix | 448-466 | 19 | |
| α-helix | 472-478 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prosaposin | A, B | protein | 82 | Homo sapiens | P07602 (AlphaFold model) |
>9I63_1 Prosaposin (chains A, B) DGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIE ILVEVLDPSFVCLKIGACPSAH
Synthetic Glycoforms Reveal Carbohydrate-Dependent Bioactivity of Human Saposin D. Graf, C.G.F., Schulz, C., Schmalzlein, M. et al. Angew Chem Int Ed Engl (2017) 56:5252-5257. DOI 10.1002/anie.201701362 · PubMed
Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9I63 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.