Crystal Structure of Human Saposin C. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Jul 2006.
Explore 2GTG in 3D Show helices and sheets RCSB PDB PDBe
2GTG contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-20 | 17 | |
| α-helix | 25-35 | 11 | |
| α-helix | 41-63 | 23 | |
| α-helix | 68-74 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Proactivator polypeptide | A | protein | 83 | Homo sapiens | P07602 (AlphaFold model) |
>2GTG_1 Proactivator polypeptide (chains A) MDSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSI LSILLEEVSPELVCSMLHLCSGT
Crystal structures of saposins A and C. Ahn, V.E., Leyko, P., Alattia, J.R. et al. Protein Sci (2006) 15:1849-1857. DOI 10.1110/ps.062256606 · PubMed
Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2GTG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.