4DDJ: Saposin A

Crystal structure of saposin A in complex with lauryldimethylamine-N-oxide (LDAO). Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Feb 2012.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 991
Mol. weight: 13.65 kDa
Ligands: LDA
Released: 15 Feb 2012

Explore 4DDJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DDJ contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2-19	18
α-helix	23-35	13
α-helix	42-66	25
α-helix	69-75	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Saposin-A	A	protein	83	Homo sapiens	P07602 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4DDJ_1 Saposin-A (chains A)
MGSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVI
LDIIKGEMSRPGEVCSALNLCES

Ligands and cofactors

ID	Name	Formula	Copies
LDA	Lauryl dimethylamine-N-oxide	C14 H31 N O	20

Primary citation

Structure of saposin A lipoprotein discs. Popovic, K., Holyoake, J., Pomes, R. et al. Proc Natl Acad Sci U S A (2012) 109:2908-2912. DOI 10.1073/pnas.1115743109 · PubMed

Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQP 1.3 Å, Crystal Structure of Human Saposin D (orthorhombic)
9I63 1.65 Å, Synthetic Human Saposin D glycoprotein
4UEX 1.8 Å, Structure of human Saposin A at lysosomal pH
2DOB 2.0 Å, Crystal Structure of Human Saposin A
3BQQ 2.0 Å, Crystal Structure of Human Saposin D (triclinic)
2RB3 2.1 Å, Crystal Structure of Human Saposin D
4V2O 2.13 Å, Structure of saposin B in complex with chloroquine
1N69 2.2 Å, Crystal structure of human saposin B
6SLR 2.38 Å, Structure of saposin B in complex with atovaquone
2GTG 2.4 Å, Crystal Structure of Human Saposin C
2QYP 2.45 Å, Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation
2R0R 2.5 Å, Crystal Structure of Human Saposin D variant SapD K9E

Browse structure collections

About this viewer

MolViewer shows 4DDJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.