1NA8: ADP-ribosylation factor binding protein GGA1

Crystal structure of ADP-ribosylation factor binding protein GGA1. Determined by X-ray diffraction at 2.3 Å resolution. Released 29 Jul 2003.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,499
Mol. weight: 34.71 kDa
Released: 29 Jul 2003

Explore 1NA8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NA8 contains 13 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	490-497	8
α-helix	504-506	3
β-strand	509	1	1
β-strand	515-520	6	1
β-strand	523-531	9	1
β-strand	540-549	10	1
β-strand	555-563	9	2
β-strand	569-572	4	1
α-helix	573-575	3
β-strand	580	1	2
α-helix	581-583	3
β-strand	592-599	8	1
α-helix	604-606	3
β-strand	608-616	9	2
β-strand	619-627	9	2
α-helix	630-632	3
α-helix	636-638	3

Chain B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	504-506	3
β-strand	509	1	3
α-helix	513-514	2
β-strand	515-520	6	3
β-strand	523-530	8	3
β-strand	540-549	10	3
β-strand	555-563	9	4
β-strand	569-572	4	3
α-helix	573-575	3
β-strand	580	1	4
α-helix	581-583	3
β-strand	592-599	8	3
β-strand	608-616	9	4
β-strand	619-627	9	4
α-helix	630-632	3
α-helix	633-635	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor binding protein GGA1	A, B	protein	154	Homo sapiens	Q9UJY5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1NA8_1 ADP-ribosylation factor binding protein GGA1 (chains A, B)
MHHHHHHMELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVV
SMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGMELPAFNPIVHPSAITQVLLLANPQKEK
VRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL

Primary citation

Binding partners for the COOH-terminal appendage domains of the GGAs and gamma-adaptin. Lui, W.W., Collins, B.M., Hirst, J. et al. Mol Cell Biol (2003) 14:2385-23898. DOI 10.1091/mbc.E02-11-0735 · PubMed

Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2J 1.6 Å, Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
1UJK 1.9 Å, VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
1JWF 2.1 Å, Crystal Structure of human GGA1 VHS domain.
1O3X 2.1 Å, Crystal structure of human GGA1 GAT domain
3G2V 2.1 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide
2DWY 2.3 Å, Crystal Structure Analysis of GGA1-GAE
3G2U 2.3 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide
1NWM 2.4 Å, GAT domain of human GGA1
3G2W 2.4 Å, VHS Domain of human GGA1 complexed with a DXXLL hinge peptide

Browse structure collections

About this viewer

MolViewer shows 1NA8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.