1NAF: Human GGA1 GAT domain

Crystal structure of the human GGA1 GAT domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 25 Mar 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,006
Mol. weight: 18.41 kDa
Released: 25 Mar 2003

Explore 1NAF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NAF contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	173-182	10
α-helix	189-234	46
α-helix	248-257	10
α-helix	259-269	11
α-helix	274-298	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor binding protein GGA1	A	protein	158	Homo sapiens	Q9UJY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NAF_1 ADP-ribosylation factor binding protein GGA1 (chains A)
MHHHHHHMKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVN
AIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEA
LAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPG

Primary citation

The Structure of the GGA1-GAT Domain Reveals the Molecular Basis for ARF Binding and Membrane Association of GGAs. Collins, B.M., Watson, P.J., Owen, D.J. Dev Cell (2003) 4:321-332. DOI 10.1016/S1534-5807(03)00037-6 · PubMed

Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2J 1.6 Å, Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
1UJK 1.9 Å, VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
1JWF 2.1 Å, Crystal Structure of human GGA1 VHS domain.
1O3X 2.1 Å, Crystal structure of human GGA1 GAT domain
3G2V 2.1 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide
1NA8 2.3 Å, Crystal structure of ADP-ribosylation factor binding protein GGA1
2DWY 2.3 Å, Crystal Structure Analysis of GGA1-GAE
3G2U 2.3 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide
1NWM 2.4 Å, GAT domain of human GGA1

Browse structure collections

About this viewer

MolViewer shows 1NAF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.