1NQ0: Thyroid hormone receptor beta-1

TR Receptor Mutations Conferring Hormone Resistance and Reduced Corepressor Release Exhibit Decreased Stability in the Nterminal LBD. Determined by X-ray diffraction at 2.4 Å resolution. Released 15 Apr 2003.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,095
Mol. weight: 30.79 kDa
Ligands: ARS, 4HY
Released: 15 Apr 2003

Explore 1NQ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NQ0 contains 16 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	203-208	6
α-helix	216-232	17
α-helix	234-235	2
α-helix	239-242	4
β-strand	244-245	2	1
α-helix	266-274	9
α-helix	276-288	13
α-helix	291-294	4
α-helix	298-318	21
β-strand	321-322	2	1
β-strand	327-330	4	1
β-strand	334-336	3	1
α-helix	338-341	4
α-helix	342-346	5
α-helix	348-360	13
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-445	29
α-helix	448-450	3
α-helix	453-459	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thyroid hormone receptor beta-1	A	protein	263	Homo sapiens	P10828 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NQ0_1 Thyroid hormone receptor beta-1 (chains A)
AAMEELQKSIGHKPEPTDEEWELIKTVTEAHVATNTQGSHWKQKRKFLPEDIGQAPIVNA
PEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAA
VRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLL
MSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASR
FLHMKVECPTELFPPLFLEVFED

Ligands and cofactors

ID	Name	Formula	Copies
ARS	Arsenic	As	6
4HY	[4-(4-hydroxy-3-iodo-phenoxy)-3,5-diiodo-phenyl]-acetic acid	C14 H9 I3 O4	1

Primary citation

Thyroid hormone receptor-beta mutations conferring hormone resistance and reduced corepressor release exhibit decreased stability in the N-terminal ligand-binding domain. Huber, B.R., Desclozeaux, M., West, B.L. et al. Mol Endocrinol (2003) 17:107-116. DOI 10.1210/me.2002-0097 · PubMed

Other PDB entries of the same protein (UniProt P10828 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KKB 1.7 Å, A novel agonist of THRb
2NLL 1.9 Å, Retinoid X receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to…
7WMH 1.97 Å, A novel chemical derivative(56) of THRB agonist
1N46 2.2 Å, Crystal structure of human tr beta ligand-binding domain complexed with a potent…
2J4A 2.2 Å, Human Thyroid hormone receptor beta ligand binding domain in complex with KB131084
3D57 2.2 Å, TR Variant D355R
3GWS 2.2 Å, Crystal Structure of T3-Bound Thyroid Hormone Receptor
2PIN 2.3 Å, Thyroid receptor beta in complex with inhibitor
7WLX 2.39 Å, A novel chemical derivative(53) of THRB agonist
1NQ2 2.4 Å, Two RTH Mutants with Impaired Hormone Binding
1XZX 2.5 Å, Thyroxine-Thyroid Hormone Receptor Interactions
3JZC 2.5 Å, Crystal Structure of TR-beta bound to the selective thyromimetic TRIAC

Browse structure collections

About this viewer

MolViewer shows 1NQ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.