The 1.66 Å X-ray structure of the B2 immunoglobulin-binding domain of streptococcal protein G and comparison to the NMR structure of the B1 domain. Determined by X-ray diffraction at 1.66 Å resolution. Released 15 Jul 1992.
Explore 1PGX in 3D Show helices and sheets RCSB PDB PDBe
1PGX contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-21 | 8 | 1 |
| β-strand | 26-33 | 8 | 1 |
| α-helix | 36-49 | 14 | |
| β-strand | 54-59 | 6 | 1 |
| β-strand | 64-69 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein G | A | protein | 83 | Streptococcus | P06654 (AlphaFold model) |
>1PGX_1 PROTEIN G (chains A) MDPGDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDD ATKTFTVTEMVTEVPVASKRKED
1.67-A X-ray structure of the B2 immunoglobulin-binding domain of streptococcal protein G and comparison to the NMR structure of the B1 domain. Achari, A., Hale, S.P., Howard, A.J. et al. Biochemistry (1992) 31:10449-10457. DOI 10.1021/bi00158a006 · PubMed
Other PDB entries of the same protein (UniProt P06654 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.