Solution structure of the tissue-type plasminogen activator kringle 2 domain complexed to 6-aminohexanoic acid an antifibrinolytic drug. Determined by solution NMR. Released 31 Jan 1994.
Explore 1PK2 in 3D Show helices and sheets RCSB PDB PDBe
1PK2 contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-17 | 2 | |
| β-strand | 21 | 1 | 1 |
| β-strand | 22 | 1 | 2 |
| β-strand | 27 | 1 | 1 |
| α-helix | 28-30 | 3 | |
| α-helix | 34-36 | 3 | |
| α-helix | 48-51 | 4 | |
| β-strand | 60 | 1 | 3 |
| β-strand | 69-74 | 6 | 3 |
| β-strand | 77-82 | 6 | 3 |
| β-strand | 83 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tissue-type plasminogen activator | A | protein | 90 | Homo sapiens | P00750 (AlphaFold model) |
>1PK2_1 TISSUE-TYPE PLASMINOGEN ACTIVATOR (chains A) SEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCR NPDGDAKPWCHVLKNRRLTWEYCDVPSCST
| ID | Name | Formula | Copies |
|---|---|---|---|
| ACA | 6-aminohexanoic acid | C6 H13 N O2 | 1 |
Solution structure of the tissue-type plasminogen activator kringle 2 domain complexed to 6-aminohexanoic acid an antifibrinolytic drug. Byeon, I.J., Llinas, M. J Mol Biol (1991) 222:1035-1051. DOI 10.1016/0022-2836(91)90592-T · PubMed
Other PDB entries of the same protein (UniProt P00750 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PK2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.