Michaelis complex of tPA-S195A:PAI-1. Determined by X-ray diffraction at 3.16 Å resolution. Released 2 Sept 2015.
Explore 5BRR in 3D Show helices and sheets RCSB PDB PDBe
5BRR contains 25 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 4 |
| β-strand | 20-21 | 2 | 5 |
| α-helix | 24-26 | 3 | |
| β-strand | 30-36 | 7 | 6 |
| β-strand | 38-48 | 11 | 6 |
| β-strand | 51-54 | 4 | 6 |
| α-helix | 56-59 | 4 | |
| α-helix | 61-63 | 3 | |
| β-strand | 64-68 | 5 | 6 |
| β-strand | 72 | 1 | 7 |
| α-helix | 76-77 | 2 | |
| β-strand | 81-90 | 10 | 6 |
| β-strand | 104-109 | 6 | 6 |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 5 |
| α-helix | 123-125 | 3 | |
| α-helix | 130-131 | 2 | |
| β-strand | 135-140 | 6 | 5 |
| β-strand | 154 | 1 | 7 |
| β-strand | 156-162 | 7 | 5 |
| α-helix | 165-167 | 3 | |
| α-helix | 169A-171 | 4 | |
| β-strand | 180-184 | 5 | 5 |
| β-strand | 189 | 1 | 4 |
| β-strand | 198-203 | 6 | 5 |
| β-strand | 206-215 | 10 | 5 |
| α-helix | 225 | 1 | |
| β-strand | 226-230 | 5 | 5 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-240 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-26 | 18 | |
| β-strand | 32-34 | 3 | 1 |
| α-helix | 36-48 | 13 | |
| α-helix | 52-62 | 11 | |
| α-helix | 71-82 | 12 | |
| β-strand | 95-100 | 6 | 2 |
| α-helix | 105-106 | 2 | |
| α-helix | 109-117 | 9 | |
| β-strand | 122-124 | 3 | 2 |
| α-helix | 130-143 | 14 | |
| α-helix | 152-156 | 5 | |
| β-strand | 163-172 | 10 | 2 |
| β-strand | 175 | 1 | 3 |
| α-helix | 178-180 | 3 | |
| β-strand | 184-189 | 6 | 1 |
| β-strand | 197-215 | 19 | 1 |
| β-strand | 219-227 | 9 | 1 |
| β-strand | 228 | 1 | 3 |
| α-helix | 229-231 | 3 | |
| β-strand | 233-240 | 8 | 1 |
| α-helix | 256-265 | 10 | |
| β-strand | 267-276 | 10 | 1 |
| β-strand | 278-285 | 8 | 2 |
| α-helix | 287-292 | 6 | |
| α-helix | 297-299 | 3 | |
| β-strand | 317-328 | 12 | 2 |
| β-strand | 351-353 | 3 | 1 |
| β-strand | 358-364 | 7 | 1 |
| β-strand | 369-376 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasminogen activator inhibitor 1 | I | protein | 379 | Homo sapiens | P05121 (AlphaFold model) |
| Tissue-type plasminogen activator | E | protein | 252 | Homo sapiens | P00750 (AlphaFold model) |
>5BRR_1 Plasminogen activator inhibitor 1 (chains I) VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQA AMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRST VKQVDFSEVERARFIINDWVKTHTKGMISHLLGTGAVDQLTRLVLVNALYFNGQWKTPFP DSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAP YEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFR QFQADFTSLSDQEPLHVALALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIIDRPFLF VVRHNPTGTVLFMGQVMEP
>5BRR_2 Tissue-type plasminogen activator (chains E) IKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTV ILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVA LPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLQRTVTDNM LCAGDTRSGGPQANLHDACQGDAGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVT NYLDWIRDNMRP
Crystal Structure of the Michaelis Complex between Tissue-type Plasminogen Activator and Plasminogen Activators Inhibitor-1. Gong, L., Liu, M., Zeng, T. et al. J Biol Chem (2015) 290:25795-25804. DOI 10.1074/jbc.M115.677567 · PubMed
Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5BRR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.