F1-G module pair residues 1-91 (C83S) of tissue-type plasminogen activator (T-pa) (NMR, 298K, PH2.95, representative structure). Determined by solution NMR. Released 15 Sept 1995.
Explore 1TPG in 3D Show helices and sheets RCSB PDB PDBe
1TPG contains 0 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| β-strand | 14 | 1 | 1 |
| β-strand | 20-24 | 5 | 2 |
| β-strand | 31-35 | 5 | 2 |
| β-strand | 42 | 1 | 2 |
| β-strand | 45-46 | 2 | 2 |
| β-strand | 48-50 | 3 | 3 |
| β-strand | 61-65 | 5 | 3 |
| β-strand | 71-74 | 4 | 3 |
| β-strand | 80 | 1 | 4 |
| β-strand | 86 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| T-plasminogen activator F1-G | A | protein | 91 | Homo sapiens | P00750 (AlphaFold model) |
>1TPG_1 T-PLASMINOGEN ACTIVATOR F1-G (chains A) SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG TCQQALYFSDFVCQCPEGFAGKSCEIDTRAT
The solution structure and backbone dynamics of the fibronectin type I and epidermal growth factor-like pair of modules of tissue-type plasminogen activator. Smith, B.O., Downing, A.K., Driscoll, P.C. et al. Structure (1995) 3:823-833. DOI 10.1016/S0969-2126(01)00217-9 · PubMed
Other PDB entries of the same protein (UniProt P00750 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TPG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.