1PML: Tissue plasminogen activator kringle 2

Kringle-kringle interactions in multimer kringle structures. Determined by X-ray diffraction at 2.38 Å resolution. Released 22 Jun 1994.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,105
Mol. weight: 28.55 kDa
Released: 22 Jun 1994

Explore 1PML in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PML contains 12 α-helices and 29 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	15	1	2
β-strand	16	1	3
α-helix	20	1
β-strand	21	1	2
α-helix	22-24	3
α-helix	28-30	3
β-strand	31	1	4
β-strand	33	1	4
α-helix	44-44C	4
β-strand	52	1	5
β-strand	62-66A	6	5
β-strand	69-74	6	5
β-strand	75	1	3
α-helix	77-78	2
β-strand	79	1	1

Chain B: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	6
β-strand	15	1	7
β-strand	16	1	8
β-strand	21	1	7
α-helix	22-24	3
α-helix	28-30	3
β-strand	52	1	9
β-strand	62-66	5	9
β-strand	70-74	5	9
β-strand	75	1	8
α-helix	77-78	2
β-strand	79	1	6

Chain C: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	10
β-strand	15	1	11
β-strand	16	1	12
α-helix	20	1
β-strand	21	1	11
α-helix	22-24	3
α-helix	44-44C	4
β-strand	52	1	13
β-strand	62-66A	6	13
β-strand	69-74	6	13
β-strand	75	1	12
α-helix	77-78	2
β-strand	79	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tissue plasminogen activator kringle 2	A, B, C	protein	86	Homo sapiens	P00750 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1PML_1 TISSUE PLASMINOGEN ACTIVATOR KRINGLE 2 (chains A, B, C)
SDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDG
DAKPWCHVLKNRRLTWEYCDVPSCST

Primary citation

Kringle-kringle interactions in multimer kringle structures. Padmanabhan, K., Wu, T.P., Ravichandran, K.G. et al. Protein Sci (1994) 3:898-910. PubMed

Other PDB entries of the same protein (UniProt P00750 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RTF 2.3 Å, Complex of benzamidine with the catalytic domain of human two chain tissue plasminogen…
1TPK 2.4 Å, Crystal structure of the kringle-2 domain of tissue plasminogen activator at 2.4-Å…
1A5H 2.9 Å, Catalytic domain of human two-chain tissue plasminogen activator complex of a…
5BRR 3.16 Å, Michaelis complex of tPA-S195A:PAI-1
1BDA 3.35 Å, Catalytic domain of human single chain tissue plasminogen activator in complex with…
5ZLZ 3.58 Å, Structure of tPA and PAI-1
1PK2 Solution structure of the tissue-type plasminogen activator kringle 2 domain complexed…
1TPG F1-G module pair residues 1-91 (C83S) of tissue-type plasminogen activator (T-pa) (NMR,…
1TPM Solution structure of the fibrin binding finger domain of tissue-type plasminogen…
1TPN Solution structure of the fibrin binding finger domain of tissue-type plasminogen…

Browse structure collections

About this viewer

MolViewer shows 1PML directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.