Solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1H nuclear magnetic resonance. Determined by solution NMR. Released 31 Jan 1994.
Explore 1TPN in 3D Show helices and sheets RCSB PDB PDBe
1TPN contains 0 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-8 | 3 | 1 |
| β-strand | 13-15 | 3 | 1 |
| β-strand | 20-23 | 4 | 2 |
| β-strand | 32-35 | 4 | 2 |
| β-strand | 42-45 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tissue-type plasminogen activator | A | protein | 50 | Homo sapiens | P00750 (AlphaFold model) |
>1TPN_1 TISSUE-TYPE PLASMINOGEN ACTIVATOR (chains A) SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS
Solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1H nuclear magnetic resonance. Downing, A.K., Driscoll, P.C., Harvey, T.S. et al. J Mol Biol (1992) 225:821-833. DOI 10.1016/0022-2836(92)90403-7 · PubMed
Other PDB entries of the same protein (UniProt P00750 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TPN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.