Crystal and molecular structure of human plasminogen kringle 4 refined at 1.9-Å resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 31 Oct 1993.
Explore 1PK4 in 3D Show helices and sheets RCSB PDB PDBe
1PK4 contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-2 | 2 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 16 | 1 | 3 |
| α-helix | 20 | 1 | |
| β-strand | 21 | 1 | 2 |
| β-strand | 22 | 1 | 4 |
| α-helix | 23-24 | 2 | |
| β-strand | 52 | 1 | 5 |
| β-strand | 62-64 | 3 | 5 |
| β-strand | 65 | 1 | 4 |
| β-strand | 72-74 | 3 | 5 |
| β-strand | 75 | 1 | 3 |
| β-strand | 78-79 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasminogen kringle 4 | A | protein | 79 | Homo sapiens | P00747 (AlphaFold model) |
>1PK4_1 PLASMINOGEN KRINGLE 4 (chains A) DCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGP WCFTTDPSVRWEYCNLKKC
Crystal and molecular structure of human plasminogen kringle 4 refined at 1.9-A resolution. Mulichak, A.M., Tulinsky, A., Ravichandran, K.G. Biochemistry (1991) 30:10576-10588. DOI 10.1021/bi00107a029 · PubMed
Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PK4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.