Kringle-kringle interactions in multimer kringle structures. Determined by X-ray diffraction at 2.38 Å resolution. Released 22 Jun 1994.
Explore 1PML in 3D Show helices and sheets RCSB PDB PDBe
1PML contains 12 α-helices and 29 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 16 | 1 | 3 |
| α-helix | 20 | 1 | |
| β-strand | 21 | 1 | 2 |
| α-helix | 22-24 | 3 | |
| α-helix | 28-30 | 3 | |
| β-strand | 31 | 1 | 4 |
| β-strand | 33 | 1 | 4 |
| α-helix | 44-44C | 4 | |
| β-strand | 52 | 1 | 5 |
| β-strand | 62-66A | 6 | 5 |
| β-strand | 69-74 | 6 | 5 |
| β-strand | 75 | 1 | 3 |
| α-helix | 77-78 | 2 | |
| β-strand | 79 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 6 |
| β-strand | 15 | 1 | 7 |
| β-strand | 16 | 1 | 8 |
| β-strand | 21 | 1 | 7 |
| α-helix | 22-24 | 3 | |
| α-helix | 28-30 | 3 | |
| β-strand | 52 | 1 | 9 |
| β-strand | 62-66 | 5 | 9 |
| β-strand | 70-74 | 5 | 9 |
| β-strand | 75 | 1 | 8 |
| α-helix | 77-78 | 2 | |
| β-strand | 79 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 10 |
| β-strand | 15 | 1 | 11 |
| β-strand | 16 | 1 | 12 |
| α-helix | 20 | 1 | |
| β-strand | 21 | 1 | 11 |
| α-helix | 22-24 | 3 | |
| α-helix | 44-44C | 4 | |
| β-strand | 52 | 1 | 13 |
| β-strand | 62-66A | 6 | 13 |
| β-strand | 69-74 | 6 | 13 |
| β-strand | 75 | 1 | 12 |
| α-helix | 77-78 | 2 | |
| β-strand | 79 | 1 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tissue plasminogen activator kringle 2 | A, B, C | protein | 86 | Homo sapiens | P00750 (AlphaFold model) |
>1PML_1 TISSUE PLASMINOGEN ACTIVATOR KRINGLE 2 (chains A, B, C) SDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDG DAKPWCHVLKNRRLTWEYCDVPSCST
Kringle-kringle interactions in multimer kringle structures. Padmanabhan, K., Wu, T.P., Ravichandran, K.G. et al. Protein Sci (1994) 3:898-910. PubMed
Other PDB entries of the same protein (UniProt P00750 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PML directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.