1PY1: ADP-ribosylation factor binding protein GGA1

Complex of GGA1-VHS domain and beta-secretase C-terminal phosphopeptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Nov 2003.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 8
Atoms: 4,776
Mol. weight: 75.65 kDa
Released: 4 Nov 2003

Explore 1PY1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PY1 contains 40 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-17	8
α-helix	27-36	10
α-helix	43-55	13
α-helix	60-76	17
α-helix	79-85	7
α-helix	88-98	11
α-helix	103-106	4
α-helix	109-125	17
α-helix	130-141	12

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-17	8
α-helix	27-37	11
α-helix	43-55	13
α-helix	60-75	16
α-helix	79-86	8
α-helix	88-98	11
α-helix	104-106	3
α-helix	109-125	17
α-helix	130-141	12

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-17	8
α-helix	27-37	11
α-helix	43-55	13
α-helix	60-75	16
α-helix	79-85	7
α-helix	88-98	11
α-helix	104-106	3
α-helix	109-125	17
α-helix	130-141	12

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-17	8
α-helix	27-37	11
α-helix	43-55	13
α-helix	60-76	17
α-helix	79-85	7
α-helix	88-98	11
α-helix	104-106	3
α-helix	109-125	17
α-helix	130-141	12

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4

Chains F and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3

Chain G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor binding protein GGA1	A, B, C, D	protein	158	Homo sapiens	Q9UJY5 (AlphaFold model)
Beta-secretase	E, F, G, H	protein	8		P56817 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1PY1_1 ADP-ribosylation factor binding protein GGA1 (chains A, B, C, D)
GSEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQ
EWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELL
YSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTF

Sequence of entity 2 (E, F, G, H), FASTA

>1PY1_2 Beta-secretase (chains E, F, G, H)
ADDISLLK

Primary citation

Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins. He, X., Zhu, G., Koelsch, G. et al. Biochemistry (2003) 42:12174-12180. DOI 10.1021/bi035199h · PubMed

Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2J 1.6 Å, Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
1UJK 1.9 Å, VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
1JWF 2.1 Å, Crystal Structure of human GGA1 VHS domain.
1O3X 2.1 Å, Crystal structure of human GGA1 GAT domain
3G2V 2.1 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide
1NA8 2.3 Å, Crystal structure of ADP-ribosylation factor binding protein GGA1
2DWY 2.3 Å, Crystal Structure Analysis of GGA1-GAE
3G2U 2.3 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide
1NWM 2.4 Å, GAT domain of human GGA1

Browse structure collections

About this viewer

MolViewer shows 1PY1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.