1QOL: Fmdv leader protease

Structure of the fmdv leader protease. Determined by X-ray diffraction at 3.0 Å resolution. Released 10 Nov 2000.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: FOOT-AND-MOUTH DISEASE VIRUS
Chains: 8
Atoms: 10,971
Mol. weight: 158.53 kDa
Released: 10 Nov 2000

Explore 1QOL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QOL contains 61 α-helices and 97 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	1
β-strand	33	1	2
β-strand	38-40	3	1
α-helix	51-63	13
α-helix	66-68	3
α-helix	69-72	4
α-helix	79-90	12
β-strand	98	1	3
α-helix	100-104	5
α-helix	108-110	3
β-strand	115-117	3	2
β-strand	124-126	3	2
α-helix	134-136	3
β-strand	137-143	7	2
β-strand	149-156	8	2
β-strand	158-163	6	2
β-strand	166-169	4	2
α-helix	174-176	3
β-strand	177-182	6	2

Chain B: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	4
β-strand	33	1	5
β-strand	38-40	3	4
α-helix	51-63	13
α-helix	66-68	3
α-helix	69-72	4
α-helix	79-90	12
α-helix	100-107	8
α-helix	108-110	3
β-strand	115-117	3	5
β-strand	124-126	3	5
α-helix	134-136	3
β-strand	137-142	6	5
β-strand	150-156	7	5
β-strand	158-162	5	5
β-strand	168-169	2	5
α-helix	174-176	3
β-strand	177-182	6	5
α-helix	183-184	2

Chain C: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	6
β-strand	33	1	7
β-strand	38-40	3	6
α-helix	51-63	13
α-helix	69-72	4
α-helix	79-90	12
α-helix	100-105	6
α-helix	114	1
β-strand	115-117	3	7
β-strand	120	1	7
β-strand	124-126	3	7
α-helix	134-136	3
β-strand	137-144	8	7
β-strand	148-156	9	7
β-strand	158-163	6	7
β-strand	166-169	4	7
α-helix	174-176	3
β-strand	177-182	6	7
α-helix	192-195	4
β-strand	200	1	3

Chain D: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	8
β-strand	33	1	9
β-strand	38-40	3	8
α-helix	51-63	13
α-helix	69-72	4
α-helix	79-90	12
α-helix	100-105	6
α-helix	108-110	3
β-strand	115-117	3	9
β-strand	120	1	9
β-strand	124-126	3	9
α-helix	134-136	3
β-strand	137-144	8	9
β-strand	148-155	8	9
β-strand	158-163	6	9
β-strand	166-169	4	9
α-helix	174-176	3
β-strand	177-182	6	9
α-helix	192-194	3

Chain E: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	10
β-strand	33	1	11
β-strand	38-40	3	10
α-helix	51-63	13
α-helix	69-72	4
α-helix	79-90	12
β-strand	98	1	12
α-helix	100-106	7
α-helix	108-110	3
β-strand	115-117	3	13
β-strand	124-126	3	13
α-helix	134-136	3
β-strand	139-142	4	13
β-strand	150-153	4	13
β-strand	155	1	11
β-strand	160-163	4	13
β-strand	166-169	4	13
α-helix	174-176	3
β-strand	177-181	5	13

Chain F: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	14
β-strand	33	1	15
β-strand	38-40	3	14
α-helix	51-63	13
α-helix	66-68	3
α-helix	69-72	4
α-helix	79-90	12
β-strand	95	1	16
β-strand	97	1	16
β-strand	98	1	17
α-helix	100-106	7
β-strand	115-117	3	18
β-strand	124-126	3	18
β-strand	137-142	6	18
β-strand	150-153	4	18
β-strand	155	1	15
β-strand	160-163	4	18
β-strand	166-169	4	18
α-helix	174-176	3
β-strand	177-182	6	18

Chain G: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	19
β-strand	33	1	20
β-strand	38-40	3	19
α-helix	51-63	13
α-helix	69-73	5
α-helix	79-90	12
α-helix	100-106	7
β-strand	115-117	3	21
β-strand	124-126	3	21
α-helix	134-136	3
β-strand	137-143	7	21
β-strand	149-154	6	21
β-strand	155	1	20
β-strand	159-160	2	21
β-strand	163	1	22
β-strand	166	1	22
β-strand	169	1	21
α-helix	174-176	3
β-strand	179-182	4	21
α-helix	193-197	5
β-strand	200	1	17

Chain H: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	23
β-strand	33	1	24
β-strand	38-40	3	23
α-helix	51-63	13
α-helix	69-72	4
α-helix	79-89	11
α-helix	100-106	7
β-strand	115-117	3	25
β-strand	120	1	25
β-strand	124-126	3	25
α-helix	130-132	3
α-helix	134-136	3
β-strand	139-143	5	25
β-strand	149-153	5	25
β-strand	155	1	24
β-strand	160-163	4	25
β-strand	166-169	4	25
α-helix	174-176	3
β-strand	177-180	4	25
α-helix	193-197	5
β-strand	200	1	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protease (nonstructural protein P20A)	A, B, C, D, E, F, G, H	protein	173	FOOT-AND-MOUTH DISEASE VIRUS	P03305

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>1QOL_1 PROTEASE (NONSTRUCTURAL PROTEIN P20A) (chains A, B, C, D, E, F, G, H)
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLED
LTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEH
AVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEPLNGEWKAKVQRKLK

Primary citation

Structure of the Foot-and-Mouth Disease Virus Leader Protease: A Papain-Like Fold Adapted for Self-Processing and Eif4G Recognition. Guarne, A., Tormo, J., Kirchweger, R. et al. EMBO J (1998) 17:7469. DOI 10.1093/EMBOJ/17.24.7469 · PubMed

Other PDB entries of the same protein (UniProt P03305), best resolution first:

6FFA 1.5 Å, FMDV Leader protease bound to substrate ISG15
4QBB 1.6 Å, Structure of the foot-and-mouth disease virus leader proteinase in complex with…
9HV9 1.8 Å, Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1
1QMY 1.9 Å, Fmdv leader protease (lbshort-C51A-C133S)
1QQP 1.9 Å, Foot-and-mouth disease virus/ oligosaccharide receptor complex.
9HVA 3.89 Å, Crystal structure of Fab34 complexed with a 18-mer peptide of FMDV VP1
2JQF Full Length Leader Protease of Foot and Mouth Disease Virus C51A Mutant
2JQG Leader Protease

Browse structure collections

About this viewer

MolViewer shows 1QOL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.