9HV9: Fab34

Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Jan 2026.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Bos taurus, Foot-and-mouth disease virus
Chains: 3
Atoms: 3,537
Mol. weight: 49.9 kDa
Ligands: MG
Released: 14 Jan 2026

Explore 9HV9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HV9 contains 15 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	205-206	2	4

Chain H: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	46-53	8	3
β-strand	56-59	4	3
α-helix	64-66	3
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	87-89	3
β-strand	91-97	7	3
β-strand	109-110	2	4
α-helix	111-113	3
β-strand	117-118	2	3
β-strand	122-124	3	3
β-strand	125-126	2	2
β-strand	132	1	5
α-helix	133-134	2
β-strand	135-140	6	6
β-strand	150-160	11	6
β-strand	161	1	5
β-strand	166-169	4	7
α-helix	170-172	3
β-strand	178-180	3	6
β-strand	184-185	2	6
β-strand	191-200	10	6
β-strand	209-215	7	7
α-helix	216-218	3
β-strand	220-226	7	7

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	8
β-strand	10-14	5	9
β-strand	19-24	6	8
β-strand	34-38	5	9
β-strand	45-48	4	9
β-strand	49	1	10
β-strand	53	1	10
β-strand	62-67	6	8
β-strand	70-75	6	8
α-helix	80-82	3
β-strand	84-91	8	9
β-strand	97-99	3	9
β-strand	103-108	6	9
β-strand	113	1	11
α-helix	114-115	2
β-strand	116-120	5	12
α-helix	121-123	3
α-helix	124-127	4
β-strand	131-141	11	12
β-strand	142	1	11
β-strand	147-152	6	13
β-strand	155-157	3	13
β-strand	161-163	3	12
α-helix	164-166	3
β-strand	167-168	2	12
β-strand	174-183	10	12
α-helix	184-188	5
β-strand	193-199	7	13
β-strand	202-208	7	13
α-helix	210-212	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
heavy chain	H	protein	238	Bos taurus
light chain	L	protein	213	Bos taurus
Capsid protein VP1	A	protein	7	Foot-and-mouth disease virus	P03305

Sequence of entity 1 (H), FASTA

>9HV9_1 heavy chain (chains H)
QVQLRESGPSLVKPSQTLSLTCTVSGFSLTDVHVGWVRQTPGKALEWVGVICNRGAIGYN
PALESRLSITEDNSKSQVSLSLSSVTTADTATYYCASSCRTEGDVGGDCDSDHFFCAWGQ
GLLVTVSSASTTAPKVYPLSSCCGDKSSSTVTLGCLVSSYMPEPVTVTWNSGALKSGVHT
FPAVLQSSGLYSLSSMVTVPGSTSGTQTFTCNVAHPASSTKVDKAVDPRCGKHHHHHH

Sequence of entity 2 (L), FASTA

>9HV9_2 light chain (chains L)
SYELTQPTSVSVALGQTAKITCSGDLLDRQYAQWYQQKPGQGPVRVIYKDSERPSGISDR
FSGSSSGKTATLTVSGAQTEDEADYYCHSADSSHYPVFGSGSTLTVLGQPKSPPSVTLFP
PSTEELNGNKATLVCLISDFYPGSVTVVWKADGSTITRNVETTRASKQSNSKYAASSYLS
LTSSDWKSKGSYSCEVTHEGSTVTKTVKPSECS

Sequence of entity 3 (A), FASTA

>9HV9_3 Capsid protein VP1 (chains A)
KIVAPVK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (SO4, PG4, GOL) are not listed.

Primary citation

Cattle antibodies identify a cross-serotype broadly neutralising foot-and-mouth disease virus epitope. Bonnet-Di Placido, M., Duyvesteyn, H.M.E., Steyn, A.W. et al. NPJ Vaccines (2026) 11. DOI 10.1038/s41541-026-01427-7 · PubMed

Other PDB entries of the same protein (UniProt P03305), best resolution first:

6FFA 1.5 Å, FMDV Leader protease bound to substrate ISG15
4QBB 1.6 Å, Structure of the foot-and-mouth disease virus leader proteinase in complex with…
1QMY 1.9 Å, Fmdv leader protease (lbshort-C51A-C133S)
1QQP 1.9 Å, Foot-and-mouth disease virus/ oligosaccharide receptor complex.
1QOL 3.0 Å, Structure of the fmdv leader protease
9HVA 3.89 Å, Crystal structure of Fab34 complexed with a 18-mer peptide of FMDV VP1
2JQF Full Length Leader Protease of Foot and Mouth Disease Virus C51A Mutant
2JQG Leader Protease

Browse structure collections

About this viewer

MolViewer shows 9HV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.