4QBB: Foot-and-mouth disease virus leader proteinase

Structure of the foot-and-mouth disease virus leader proteinase in complex with inhibitor (N~2~-[(3S)-4-({(2R)-1-[(4-CARBAMIMIDAMIDOBUTYL)AMINO]-4-METHYL-1-OXOPENTAN-2-YL}AMINO)-3-HYDROXY-4-OXOBUTANOYL]-L-ARGINYL-L-PROLINAMIDE). Determined by X-ray diffraction at 1.6 Å resolution. Released 5 Nov 2014.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Foot-and-mouth disease virus
Chains: 3
Atoms: 4,440
Mol. weight: 59.14 kDa
Ligands: E69, PO4
Released: 5 Nov 2014

Explore 4QBB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QBB contains 24 α-helices and 29 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	1
β-strand	38-40	3	1
α-helix	51-63	13
α-helix	69-72	4
α-helix	79-90	12
α-helix	100-106	7
α-helix	108-110	3
β-strand	115-117	3	2
β-strand	124-126	3	2
α-helix	134-136	3
β-strand	137-143	7	2
β-strand	149-153	5	2
β-strand	160-163	4	2
β-strand	166-169	4	2
α-helix	171-173	3
α-helix	174-176	3
β-strand	177-182	6	2

Chain B: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	3
β-strand	38-40	3	3
α-helix	51-63	13
α-helix	69-72	4
α-helix	79-90	12
α-helix	100-107	8
α-helix	108-110	3
β-strand	115-117	3	4
β-strand	124-126	3	4
α-helix	134-136	3
β-strand	137-143	7	4
β-strand	149-153	5	4
β-strand	160-163	4	4
β-strand	166-169	4	4
α-helix	171-173	3
α-helix	174-176	3
β-strand	177-182	6	4

Chain C: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	5
β-strand	38-40	3	5
α-helix	51-63	13
α-helix	69-72	4
α-helix	79-90	12
β-strand	95	1	6
β-strand	97	1	6
α-helix	100-107	8
α-helix	108-110	3
β-strand	115-117	3	7
β-strand	124-126	3	7
α-helix	134-136	3
β-strand	137-143	7	7
β-strand	149-155	7	7
β-strand	158-163	6	7
β-strand	166-169	4	7
α-helix	171-173	3
α-helix	174-176	3
β-strand	177-182	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leader protease	A, B, C	protein	167	Foot-and-mouth disease virus	P03305

Sequence of entity 1 (A, B, C), FASTA

>4QBB_1 Leader protease (chains A, B, C)
MELTLYNGEKKTFYSRPNNHDNCWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLED
LTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEH
AVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEPLNGEWKAK

Ligands and cofactors

ID	Name	Formula	Copies
E69	N~2~-[(3S)-4-({(2R)-1-[(4-carbamimidamidobutyl)amino]-4-methyl-1-oxopentan-2-yl…	C26 H49 N11 O6	3
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (K) are not listed.

Primary citation

Foot-and-mouth disease virus leader proteinase: Structural insights into the mechanism of intermolecular cleavage. Steinberger, J., Grishkovskaya, I., Cencic, R. et al. Virology (2014) 468-470C:397-408. DOI 10.1016/j.virol.2014.08.023 · PubMed

Other PDB entries of the same protein (UniProt P03305), best resolution first:

6FFA 1.5 Å, FMDV Leader protease bound to substrate ISG15
9HV9 1.8 Å, Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1
1QMY 1.9 Å, Fmdv leader protease (lbshort-C51A-C133S)
1QQP 1.9 Å, Foot-and-mouth disease virus/ oligosaccharide receptor complex.
1QOL 3.0 Å, Structure of the fmdv leader protease
9HVA 3.89 Å, Crystal structure of Fab34 complexed with a 18-mer peptide of FMDV VP1
2JQF Full Length Leader Protease of Foot and Mouth Disease Virus C51A Mutant
2JQG Leader Protease

Browse structure collections

About this viewer

MolViewer shows 4QBB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.