2JQF: Genome polyprotein

Full Length Leader Protease of Foot and Mouth Disease Virus C51A Mutant. Determined by solution NMR. Released 17 Jul 2007.

Method: Solution NMR
Organism: Foot-and-mouth disease virus (strain O1)
Chains: 2
Atoms: 2,735
Mol. weight: 39.56 kDa
Released: 17 Jul 2007

Explore 2JQF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JQF contains 12 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	1
β-strand	38-40	3	1
α-helix	51-62	12
α-helix	69-72	4
α-helix	79-90	12
α-helix	100-106	7
α-helix	108-110	3
β-strand	115-117	3	2
β-strand	124-126	3	2
β-strand	137-142	6	2
β-strand	150-155	6	2
β-strand	158-163	6	2
β-strand	166-169	4	2
β-strand	177-182	6	2

Chain S: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	230-232	3	3
β-strand	238-240	3	3
α-helix	251-262	12
α-helix	269-272	4
α-helix	279-290	12
α-helix	300-306	7
α-helix	314	1
β-strand	315-317	3	4
β-strand	324-326	3	4
α-helix	334-336	3
β-strand	337-342	6	4
β-strand	350-355	6	4
β-strand	358-363	6	4
β-strand	366-369	4	4
β-strand	377-382	6	4
α-helix	391-393	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein	R, S	protein	173	Foot-and-mouth disease virus (strain O1)	P03305

Sequence of entity 1 (R, S), FASTA

>2JQF_1 Genome polyprotein (chains R, S)
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLED
LTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEH
AVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEPLNGEWKAKVQRKLK

Primary citation

Investigating the Substrate Specificity and Oligomerisation of the Leader Protease of Foot and Mouth Disease Virus using NMR. Cencic, R., Mayer, C., Juliano, M.A. et al. J Mol Biol (2007) 373:1071-1087. DOI 10.1016/j.jmb.2007.08.061 · PubMed

Other PDB entries of the same protein (UniProt P03305), best resolution first:

6FFA 1.5 Å, FMDV Leader protease bound to substrate ISG15
4QBB 1.6 Å, Structure of the foot-and-mouth disease virus leader proteinase in complex with…
9HV9 1.8 Å, Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1
1QMY 1.9 Å, Fmdv leader protease (lbshort-C51A-C133S)
1QQP 1.9 Å, Foot-and-mouth disease virus/ oligosaccharide receptor complex.
1QOL 3.0 Å, Structure of the fmdv leader protease
9HVA 3.89 Å, Crystal structure of Fab34 complexed with a 18-mer peptide of FMDV VP1
2JQG Leader Protease

Browse structure collections

About this viewer

MolViewer shows 2JQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.