2JQG: Leader Protease

Leader Protease. Determined by solution NMR. Released 24 Jul 2007.

Method: Solution NMR
Organism: Foot-and-mouth disease virus (strain O1)
Chains: 1
Atoms: 1,346
Mol. weight: 19.02 kDa
Released: 24 Jul 2007

Explore 2JQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JQG contains 7 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	30-32	3	1
β-strand	33	1	2
β-strand	38-40	3	1
α-helix	51-59	9
α-helix	60-64	5
α-helix	69-72	4
α-helix	79-90	12
α-helix	100-104	5
α-helix	105-106	2
β-strand	115-116	2	3
β-strand	117	1	4
β-strand	120	1	4
β-strand	124-125	2	3
α-helix	134-136	3
β-strand	137-143	7	2
β-strand	149-155	7	2
β-strand	158-163	6	2
β-strand	166-169	4	2
β-strand	177-182	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein	R	protein	167	Foot-and-mouth disease virus (strain O1)	P03305

Sequence of entity 1 (R), FASTA

>2JQG_1 Genome polyprotein (chains R)
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLED
LTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEH
AVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQEPLNGEWKAK

Primary citation

Investigating the Substrate Specificity and Oligomerisation of the Leader Protease of Foot and Mouth Disease Virus using NMR. Cencic, R., Mayer, C., Juliano, M.A. et al. J Mol Biol (2007) 373:1071-1087. DOI 10.1016/j.jmb.2007.08.061 · PubMed

Other PDB entries of the same protein (UniProt P03305), best resolution first:

6FFA 1.5 Å, FMDV Leader protease bound to substrate ISG15
4QBB 1.6 Å, Structure of the foot-and-mouth disease virus leader proteinase in complex with…
9HV9 1.8 Å, Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1
1QMY 1.9 Å, Fmdv leader protease (lbshort-C51A-C133S)
1QQP 1.9 Å, Foot-and-mouth disease virus/ oligosaccharide receptor complex.
1QOL 3.0 Å, Structure of the fmdv leader protease
9HVA 3.89 Å, Crystal structure of Fab34 complexed with a 18-mer peptide of FMDV VP1
2JQF Full Length Leader Protease of Foot and Mouth Disease Virus C51A Mutant

Browse structure collections

About this viewer

MolViewer shows 2JQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.