1QRZ: Catalytic domain of plasminogen

Catalytic domain of plasminogen. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Oct 1999.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,097
Mol. weight: 108.08 kDa
Released: 14 Oct 1999

Explore 1QRZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QRZ contains 43 α-helices and 76 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	566-567	2	1
α-helix	568-569	2
β-strand	576-580	5	2
β-strand	586-594	9	2
β-strand	597-601	5	2
α-helix	602-605	4
α-helix	611-613	3
β-strand	615-618	4	2
β-strand	622	1	3
β-strand	631-640	10	2
β-strand	647-652	6	2
α-helix	655-658	4
α-helix	664-665	2
β-strand	666	1	1
α-helix	667-669	3
α-helix	674-675	2
β-strand	679-684	6	1
β-strand	696	1	3
β-strand	698-705	8	1
α-helix	707-710	4
β-strand	724-727	4	1
β-strand	736	1	4
β-strand	744-749	6	1
β-strand	752-759	8	1
α-helix	761-763	3
β-strand	766	1	4
β-strand	767	1	5
β-strand	770	1	5
β-strand	772-776	5	1
α-helix	777-779	3
α-helix	781-790	10

Chain B: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	566-567	2	6
α-helix	568-569	2
β-strand	576-580	5	7
β-strand	586-594	9	7
β-strand	597-601	5	7
α-helix	602-605	4
α-helix	611-613	3
β-strand	615-618	4	7
β-strand	622	1	8
β-strand	631-640	10	7
β-strand	647-652	6	7
α-helix	655-657	3
α-helix	664-665	2
β-strand	666	1	6
α-helix	667-669	3
α-helix	674-675	2
β-strand	679-684	6	6
β-strand	696	1	8
β-strand	698-705	8	6
α-helix	707-710	4
β-strand	724-727	4	6
β-strand	744-749	6	6
β-strand	752-759	8	6
α-helix	761-763	3
β-strand	767	1	9
β-strand	770	1	9
β-strand	772-776	5	6
α-helix	777-779	3
α-helix	781-790	10

Chain C: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	566-567	2	10
α-helix	568-569	2
β-strand	576-580	5	11
β-strand	586-594	9	11
β-strand	597-601	5	11
α-helix	602-605	4
α-helix	611-613	3
β-strand	615-618	4	11
β-strand	622	1	12
β-strand	631-640	10	11
β-strand	647-652	6	11
α-helix	655-658	4
α-helix	664-665	2
β-strand	666	1	10
α-helix	674-675	2
β-strand	679-684	6	10
β-strand	696	1	12
β-strand	698-705	8	10
α-helix	707-710	4
β-strand	724-727	4	10
β-strand	744-749	6	10
β-strand	752-759	8	10
α-helix	761-763	3
β-strand	767	1	13
β-strand	770	1	13
β-strand	772-776	5	10
α-helix	777-780	4
α-helix	781-790	10

Chain D: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	566-567	2	14
α-helix	568-569	2
β-strand	576-580	5	15
β-strand	586-594	9	15
β-strand	597-601	5	15
α-helix	602-605	4
α-helix	611-613	3
β-strand	615-618	4	15
β-strand	622	1	16
β-strand	631-640	10	15
β-strand	647-652	6	15
α-helix	656-658	3
α-helix	664-665	2
β-strand	666	1	14
α-helix	667-669	3
α-helix	674-675	2
β-strand	679-684	6	14
β-strand	696	1	16
β-strand	698-705	8	14
α-helix	707-710	4
β-strand	724-727	4	14
β-strand	736	1	17
β-strand	744-749	6	14
β-strand	752-759	8	14
α-helix	761-763	3
β-strand	766	1	17
β-strand	767	1	18
β-strand	770	1	18
β-strand	772-776	5	14
α-helix	777-780	4
α-helix	781-789	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen	A, B, C, D	protein	246	Homo sapiens	P00747 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1QRZ_1 PLASMINOGEN (chains A, B, C, D)
FDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGQHFCGGTLISPEWVLTAAHCL
EKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPA
CLPSPNYMVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTEL
CAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIE
GVLRNN

Primary citation

Crystal structure of the proenzyme domain of plasminogen. Peisach, E., Wang, J., de los Santos, T. et al. Biochemistry (1999) 38:11180-11188. DOI 10.1021/bi991130r · PubMed

Other PDB entries of the same protein (UniProt P00747 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UGG 1.2 Å, Protease Inhibitor
6D3Y 1.32 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
5UGD 1.38 Å, Protease Inhibitor
6D40 1.43 Å, Highly Potent and Selective Plasmin Inhibitors Based on the Sunflower Trypsin…
8F7U 1.47 Å, Macrocyclic Plasmin Inhibitor
7UAH 1.57 Å, Macrocyclic plasmin inhibitor
8F7V 1.65 Å, Macrocyclic plasmin inhibitor
5HPG 1.66 Å, Structure and ligand determinants of the recombinant kringle 5 domain of human plasminogen
1KRN 1.67 Å, Structure of kringle 4 at 4C temperature and 1.67 Å resolution
6OG4 1.7 Å, plasminogen binding group A streptococcal M protein
1KI0 1.75 Å, The X-ray Structure of Human Angiostatin
4CIK 1.78 Å, plasminogen kringle 1 in complex with inhibitor

Browse structure collections

About this viewer

MolViewer shows 1QRZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.