1RTN: Rantes

Name: PDB 1RTN: Proton NMR assignments and solution conformation of rantes, a chemokine of the cc type
Published: 1995-06-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chemokine

Proton NMR assignments and solution conformation of rantes, a chemokine of the cc type. Determined by solution NMR. Released 3 Jun 1995.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,102
Mol. weight: 15.72 kDa
Released: 3 Jun 1995

Explore 1RTN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RTN contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	1
α-helix	21-23	3
β-strand	26-30	5	2
β-strand	38-42	5	2
β-strand	48-51	4	2
α-helix	58-65	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rantes	A, B	protein	68	Homo sapiens	P13501 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1RTN_1 RANTES (chains A, B)
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVRE
YINSLEMS

Primary citation

Proton NMR assignments and solution conformation of RANTES, a chemokine of the C-C type. Skelton, N.J., Aspiras, F., Ogez, J. et al. Biochemistry (1995) 34:5329-5342. DOI 10.1021/bi00016a004 · PubMed

Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5COY 1.44 Å, Crystal structure of CC chemokine 5 (CCL5)
6STK 1.52 Å, Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation
1B3A 1.6 Å, Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV…
1EQT 1.6 Å, Met-rantes
6AEZ 1.63 Å, Crystal structure of human CCL5 trimer
1U4P 1.7 Å, Crystal Structure of human RANTES mutant K45E
2VXW 1.7 Å, Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
1U4L 2.0 Å, human RANTES complexed to heparin-derived disaccharide I-S
1U4M 2.0 Å, human RANTES complexed to heparin-derived disaccharide III-S
1U4R 2.2 Å, Crystal Structure of human RANTES mutant 44-AANA-47
5UIW 2.2 Å, Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV…
5L2U 2.28 Å, Oligomer crystal structure of CC chemokine 5 (CCL5)

Browse structure collections

About this viewer

MolViewer shows 1RTN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.