1RW5: Human prolactin

Solution structure of human prolactin. Determined by solution NMR. Released 22 Feb 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,606
Mol. weight: 22.93 kDa
Released: 22 Feb 2005

Explore 1RW5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RW5 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	15-31	17
α-helix	32-36	5
α-helix	37-41	5
α-helix	59-62	4
α-helix	69-75	7
α-helix	79-103	25
α-helix	111-137	27
α-helix	161-193	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prolactin	A	protein	199	Homo sapiens	P01236 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RW5_1 Prolactin (chains A)
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHT
SSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIE
EQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSH
KIDNYLKLLKCRIIHNNNC

Primary citation

Solution structure of human prolactin. Teilum, K., Hoch, J.C., Goffin, V. et al. J Mol Biol (2005) 351:810-823. DOI 10.1016/j.jmb.2005.06.042 · PubMed

Other PDB entries of the same protein (UniProt P01236 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3N06 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the extracellular…
3NCE 2.0 Å, A mutant human Prolactin receptor antagonist H27A in complex with the mutant…
3MZG 2.1 Å, Crystal structure of a human prolactin receptor antagonist in complex with the…
3N0P 2.1 Å, A mutant human Prolactin receptor antagonist H30A in complex with the extracellular…
3NCB 2.1 Å, A mutant human Prolactin receptor antagonist H180A in complex with the extracellular…
3D48 2.5 Å, Crystal structure of a prolactin receptor antagonist bound to the extracellular domain…
3NCC 2.5 Å, A human Prolactin receptor antagonist in complex with the mutant extracellular domain…
2Q98 2.7 Å, X-ray structure of a prolactin antagonist
3NCF 2.8 Å, A mutant human Prolactin receptor antagonist H30A in complex with the mutant…
3NPZ 3.35 Å, Prolactin Receptor (PRLR) Complexed with the Natural Hormone (PRL)
3EW3 3.8 Å, the 1:2 complex between a Nterminal elongated prolactin and the extra cellular domain of…

Browse structure collections

About this viewer

MolViewer shows 1RW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.