1SJ7: Talin Rod 482-655

Crystal Structure of Talin Rod 482-655. Determined by X-ray diffraction at 2.5 Å resolution. Released 24 Aug 2004.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,731
Mol. weight: 55.24 kDa
Ligands: PT
Released: 24 Aug 2004

Explore 1SJ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SJ7 contains 18 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	493-512	20
α-helix	516-520	5
α-helix	526-560	35
α-helix	570-600	31
α-helix	606-625	20
α-helix	634-652	19

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	486-489	4
α-helix	490-512	23
α-helix	527-560	34
α-helix	567-600	34
α-helix	606-624	19
α-helix	634-652	19

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	495-510	16
α-helix	516-521	6
α-helix	527-560	34
α-helix	570-601	32
α-helix	606-624	19
α-helix	635-653	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin 1	A, B, C	protein	174	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1SJ7_1 Talin 1 (chains A, B, C)
RGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKH
EIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDE
GGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQI

Ligands and cofactors

ID	Name	Formula	Copies
PT	Platinum (II) ion	Pt	7

Primary citation

Activation of a vinculin-binding site in the talin rod involves rearrangement of a five-helix bundle. Papagrigoriou, E., Gingras, A.R., Barsukov, I.L. et al. EMBO J (2004) 23:2942-2951. DOI 10.1038/sj.emboj.7600285 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex

Browse structure collections

About this viewer

MolViewer shows 1SJ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.